Home 

Gene Symbol:  
BATR1942_14115
Organism:  
Bacillus atrophaeus 1942
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2767086..2768810 [-1], 1725 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003974676.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1725 bp
>BATR1942_14115|ThioFinder1181 Bacillus atrophaeus 1942
ATGAAAAACACTTCAGTCATGTCTGCGGAACAAGTCGGTCATGCGGCATATTTCGATCCGAATTTTAATT
TGCCGAAAAAACCGCGTTTAATGGCAAGCCTTCAAATGATTCCTGACCAAGATTCTCTGTTGTTCCATGG
AACGGAAAATTTACAGGTGCTGAAGGGAAATGCCGTGACACGGTTTTTGCCGAAACTGATACCTTTTCTA
AATGGTGCATATTCTCTAGAGGAAATCATAAAAGAATTTGACCAATATTCTCCGAGGGATGTCAGTAACA
TTCTCTCACTATTGTTCATGCGCGGTCTGCTTGACGACGCGGAGGGAGATGAGGGGGTCGATATCAGCCA
TTTCGATGCTGATGTGCTGCATTTTTTCCAGCGGAGCACGGACTCCACCAGGGTAAACAGAAGCGCGGCT
GAAGGCCTGAATAGATTAAAAACCGCCAAGATCCTGCTGCTGACAGATTCAGATCACGGAAAAATCCTTC
AAGATGAACTTCTGTTTATGGGGGCAGACCATGTCAGAGCAGAACTGCTTTCAGATGAAGTGAAGCTTGA
TCAAGCAACAAACGTCATTGTCTTTTGCACGAACCCTTTGAATCACGAGCGTCTGCTTTCGTTAGACCAT
CTTTGCCGTGAGAAAAATATTCCCTGGCTCCTCACACGGGTTACAGAGGAATGCGGTGTAGTCGGTCCTT
ATTTTGAAAAAAATGAAACAGCGGCCTATCATGATTATAAAAAAACGGTTGAATCAGAAGAAAACAATGG
TGCGTCCGACTTGGATCATATTGAAATGTGGGAATACTATTCTGCGATTGAAATTGCTTATTTCATTACA
AGACTCGCACCTTCGGCAACGGGGTCGGAATATTTAACCTTTCAATTTAATGATTGGACAAGCACCAGCA
AAAAAGTACATCCAAGACCGGATGGCATATGCGCTTCCGGCAGCTCCGAGAATGAACTTCACCCGGCATT
GCAATTTGAGAATGCCATCGCCTTTCCATCGAAACATTTAATTAACCCTAAAAGTCATCAAGTCCATTAC
AATCCGAAGAATCTCTTATTAACAAATGAAGCAAAAAACTATCCGAGCGCGGCTTTAACTGGGCTGCCGA
AAGAAGAATCCCTTCCGCATCCAAAGGGCAGTTTTTTGAAAAATAGATATGAGCCAATTCCTGTGAAGGA
AGAATTGAATCTCGAATCATTGACCCGTCTGTTTCTCACAAGCGGAGGCTTAAGAGATGCCGGCAGCGGC
CAGGTTTCCGACAAAGTGCAAAGATGGGCGCCGACGGGCGGTAATTTAGGATCATGCCAGATTTATATTC
TTGCGCTGTCTGTAAAAGGACTAGTCCCTAATTGTTACTATTATCAGCATTTAGACCACTCCTTGGCGAA
AATCGGCCCTTCTTTAACTGAGGAAGAGATAAAGAAACAAATGACTGATATAACCGGTCTGACAGAGGAT
CAGCTTCCAAAGGCTCTTGTGGTCTTTACCGGCGCTTATGAAAGGGTGGCCAGCAAATATAACGGATTCG
CATATAAAGTGATCCATTTGGATGCCGGTGTCGCTTTATCGCAAATGCATGCTGTATCAACCGGACTTGG
AATCACATTAAGTGCAGTTGATCAGTGGAACGAGCAAGAGCTTATAACCTGCTTGGGATTAGATCCTAAA
AAAGAACCGGTTACCGCGGTAGCCGGAATAGATGACGGGCGGTGA
 Primer design

Protein Sequence:574 a.a.
>BATR1942_14115|ThioFinder1181 Bacillus atrophaeus 1942
MKNTSVMSAEQVGHAAYFDPNFNLPKKPRLMASLQMIPDQDSLLFHGTENLQVLKGNAVTRFLPKLIPFL
NGAYSLEEIIKEFDQYSPRDVSNILSLLFMRGLLDDAEGDEGVDISHFDADVLHFFQRSTDSTRVNRSAA
EGLNRLKTAKILLLTDSDHGKILQDELLFMGADHVRAELLSDEVKLDQATNVIVFCTNPLNHERLLSLDH
LCREKNIPWLLTRVTEECGVVGPYFEKNETAAYHDYKKTVESEENNGASDLDHIEMWEYYSAIEIAYFIT
RLAPSATGSEYLTFQFNDWTSTSKKVHPRPDGICASGSSENELHPALQFENAIAFPSKHLINPKSHQVHY
NPKNLLLTNEAKNYPSAALTGLPKEESLPHPKGSFLKNRYEPIPVKEELNLESLTRLFLTSGGLRDAGSG
QVSDKVQRWAPTGGNLGSCQIYILALSVKGLVPNCYYYQHLDHSLAKIGPSLTEEEIKKQMTDITGLTED
QLPKALVVFTGAYERVASKYNGFAYKVIHLDAGVALSQMHAVSTGLGITLSAVDQWNEQELITCLGLDPK
KEPVTAVAGIDDGR