Home 

Gene Symbol:  
BATR1942_14120
Organism:  
Bacillus atrophaeus 1942
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2768807..2769472 [-1], 666 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003974677.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:666 bp
>BATR1942_14120|ThioFinder1182 Bacillus atrophaeus 1942
ATGAAACCCATTCATATTATGTCGTCAGGAGCTTTTGGGGAAGAAGTGGCAGAGCAATTCTCCAAGAGGT
ATCAAAACACTGCTGTTACGGCATTACCCGAGCCTATGTATCTACTGCCGTCAGATCGCTTCCCGTCTGC
ACGTTTACATATTTTTGCTTCTTGGAAATCATCTTCATACATTTCGAAACAATTAGATCAGCTTTTCTTT
AAATGGAGAGAACCGTGGCTGCCGATTACCATGGACCATCCTTATGTCAGAATAGGCCCTCTTGTCATCC
CGGGTGAAGGACCGTGCTTTCACTGCTTTGAATCGAGGTCTTTACAGCACTCGCCGGTTCCTCAGTATGT
CAGAAAGATGGATGATTATTATCACAGGCATCCAGATGCGGGGCCGAAAGGGTATTTACGAAGCTTTGCA
GGCTGGTCAGCCGTCTTTGCCTCGACAATTATAAAATCAATCGATAAAGATGCGCCGTCATTAGCCGGTT
CAATCTGGCAGATGAATATGCTGACAAGAGAGTCTTTCCGCTCCAAAACGGTAGGCATCCACGGCTGTCC
CAGATGCGGGTTAAAACGGCCTGAGGAAAATCGGAGTGTGGCGCAGTTATCTGAAAGCCTTCAATCGTTG
TTAGGCGAAAGAAGAGGGGAGGCGCTCACAAAATGA
 Primer design

Protein Sequence:221 a.a.
>BATR1942_14120|ThioFinder1182 Bacillus atrophaeus 1942
MKPIHIMSSGAFGEEVAEQFSKRYQNTAVTALPEPMYLLPSDRFPSARLHIFASWKSSSYISKQLDQLFF
KWREPWLPITMDHPYVRIGPLVIPGEGPCFHCFESRSLQHSPVPQYVRKMDDYYHRHPDAGPKGYLRSFA
GWSAVFASTIIKSIDKDAPSLAGSIWQMNMLTRESFRSKTVGIHGCPRCGLKRPEENRSVAQLSESLQSL
LGERRGEALTK