Home 

Gene Symbol:  
CULC809_01699
Organism:  
Corynebacterium ulcerans 809
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1905978..1906991 [1], 1014 bp
Product Function:  
hypothetical protein
Product Locus:  
 AEG82231.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1014 bp
>CULC809_01699|ThioFinder1214 Corynebacterium ulcerans 809
ATGCGCACAACCGACCCCTGGCTCGCTTTTCATATTTTTTATGGAGAAGATCCCTCTCTTTTGCTCCGCG
ACTGCCTACTGCCCTTTGCTCATGCATGCGTGACAGAAGGCCTAGTACAACGGTTCTTCCATATGAATTA
CTGGTTGGAGGGCGCACATGTCCGCTTAAGGCTAGAGCTTTGCAATCCGGCAGATCGCGAGCACGTCATA
TGCGCAGCACATCAGGCTATCCAACCGTGGATTGACGCTCATCCTTCCAGCGCACCCCAACTGTCGCTGC
GCAATCCCGAAGGCTATCGGCGCCTCTTTGAACACGAGTACCCCATGTCCAGGTTCTCCGACTACATCGA
TCAGGATGGCCTGCCGCGCCTAGAACCAGATAACTGCATCCGAGAGCGCTACTACGAGCGTGAATATGAC
CGCTACGGCGGACGGATAGGGATGTCGCTTAGCCAAGATGTTTTTCAAACCTCGACATTGTTCGTCGAAA
AGCTTTTACACTCTGGCGTTTTAGAAGCACGTACTTCACGATTAGCCGCGGCCGCGCTAGGAATGATCTG
CACTGCGCATACGGTTTTGGATTCCGACGCATCCATAGGACACTTTTGGGAAAGCTACCACGCAGGTTGG
ACCTCGTCTTTTTCTATGCCCACCAGCTACACCTCGCCCACGGCACAGCACAAAATCTCCGCTGAGGCTC
AGGCGCTCTCACGCGCAGCCACGCCGTTTCGTGAAGCCTTACGCCGCGCCCCAGACGGCTCAGGTCTCCC
CGAACCCTATGCCACTTTCACTCAACGCATGACGTCTGCAGTGGAGAAACTCCATGCGGCGCATGCCTCT
CACGAGCTTGATTTTGGTGATTCTGCGGCAGAGGCCGGCCACACGTGGAAAGAGAACTCCATTTTTCTTC
TGCGCTCTTATGTCCACATGACCAACAACAGGATGTCCGTCAATATCTCAGATGAAGCCTATTTAGCTTA
TTTACTGCACGCGTTATATCAGGAGGCAATATGA
 Primer design

Protein Sequence:337 a.a.
>CULC809_01699|ThioFinder1214 Corynebacterium ulcerans 809
MRTTDPWLAFHIFYGEDPSLLLRDCLLPFAHACVTEGLVQRFFHMNYWLEGAHVRLRLELCNPADREHVI
CAAHQAIQPWIDAHPSSAPQLSLRNPEGYRRLFEHEYPMSRFSDYIDQDGLPRLEPDNCIRERYYEREYD
RYGGRIGMSLSQDVFQTSTLFVEKLLHSGVLEARTSRLAAAALGMICTAHTVLDSDASIGHFWESYHAGW
TSSFSMPTSYTSPTAQHKISAEAQALSRAATPFREALRRAPDGSGLPEPYATFTQRMTSAVEKLHAAHAS
HELDFGDSAAEAGHTWKENSIFLLRSYVHMTNNRMSVNISDEAYLAYLLHALYQEAI