Home 

Gene Symbol:  
CULC809_01698
Organism:  
Corynebacterium ulcerans 809
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1903378..1905978 [1], 2601 bp
Product Function:  
hypothetical protein
Product Locus:  
 AEG82230.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2601 bp
>CULC809_01698|ThioFinder1213 Corynebacterium ulcerans 809
ATGACAACCATTTCATGGAAGCTTCTTAATGAAGCCCTGGTTCGCAGCTGCAGTGTGCCGTATGAAGCGT
TGCGGCAGCTTTGCGACGCTCCCACCGACGCACTACTTACTGCCGATCTGGACCAGCGACTCCGCGTAGA
CGCGGCCCTTGATGCCCTTGGTTCTGCGGCCCGCCAGGACGTCGCGGGGTGTACACACACAGTGTTGCGC
CACACGCTACTCGATCTCAAGCGAGCTGCACACCACCATGACGTGCACAAAGTTCGTGCCCTACTGGCTA
AAGCTACATCCGCTGGTGTGCGGTTGCCTGCTGGCGTAACGACTGCCGCAGATACGGTGATCACTGCCGC
CGAAAACGTGCTGTCCTCAGAGCAGCTGCACAAGGTACTCATGAGTTCCAAGAAAAGAGAGCGCGAGTGC
CTCGGGAAGATCGCCCGTGACCTGGGAGTCGATTCAGCAGTACTGGCCGCATCAGTCCCAGCGGCAAAAG
CGATCCGGAAACTGAGTACAGATTGTGCGATGTCTGCCAAGCAGCTAGCTCGTGCCCACCGCACCGCGCT
GGGATACGTGATCCGCAGCGCCACCCGGTCAGTACCGTTTTCCGCCCTGTGCGCAATCGCGCCGTCTCAG
TTGTCCCGCGCCAGCCTGCACTCGGATGAGACTCTTGCCCCAACATCTGTGCACACTATTGCGCGTTGGA
ACGTCTACGCCATGGCTCAGATTTTCTCTGCTATGAAGAAGGACTTTGGTTTTATTGCCACACTTCCGGT
TCTGGTTAATCCTGACGCGTTATCAGAGCATGGTCACTGCGCACTGCCTCGGTGTTCTGTCGAATATCTA
GGGCACGTCGGCGACCGGGACTTGGCCGTTTACCGGGAGGAACGCCGAGTGGTCGATTCCAATGGATTAT
TTGGAAAGGTCATGGCCTTAGCCGCAAGTGCTCCCCAAAACCACGAATACACGTGTGAACAGCTGGCCGC
AGAGCTCTCGGCGCGTACAGGTTTAAGCAAGGCACAAACAAAGTGCATTGTTCTCGATGCCATCCGAATT
TCGGCCTTAGTTGTTCCCACTCTTGACCTATCCCCGTCCACAGCGGTATCTGAACAGCCGATAGTTACGC
ACTTGGCACGTGGGTCGGACAAGGCCGTATCTGCTGCGCGTCTCATTGCCCGCATCGCGGAGGAATGCAA
CGCGGTGGCGTCGATAAGCGACTTTGACCGCAGGCACACTCAGATTCTAGATATCGCGCACCACCTGGAT
AGCCTCCGGCGACTCGTCGATCCCAGCATGCCGATGTTCCATACCCATGTGTATGAGGATGGGGTCGGGA
AAGAATCGACGATTCCCTCCTCCATCGCGGACTTGTGCACAGCCCTTGACTGGGAAGCTCTCGCAGACCT
AGTCGATCTGCTTGATGTGCGGCAGGCAGAACGCGCGTTGTTTGAGGAGTTTGTGTCCGCAAAATTCCCC
CGTGGGGAAATCTGCCACGATGTTCCGGCGCTGGTCAACAGTTTTGTCGCCGAGGTCCTCACGCCACTGC
GCCAAATTGATATTGAGGCAGTCGATGAAAATGACCTGAAGTCCACTGCATCTTTGCCGCTGGGTAAGGC
TTGGGAATGGATCCGTGCGCGGCGTCGCTTCCTGGCACACGTGGCAGCATTAAGAAGCAACGCCGCTGGC
CCCGTGGACATACGTGATCTCCTCATCGATCATCGCCCTCTTGTGCAATCGCGTAGATATCCGCTTCGGT
CTTTGAACGCTTATGTTCAGCAAGGCGACAAAGCCAAGATCGTGATTAACCGGACGCTTGGCGGGCCAGG
TTTTCCGTGGTCTCGGTTCGCGCATGCGATGCCAGATTCCGCAACACGTGCATGGTCCGAATTATCTGAT
TATGCGTCTGATGCGGGAGTGAAACTCGTCGAGCTGACAGCCGGAAAAGTCGTCTCCAACCTCAACGCGC
ATCCGGCTACCTATCCAACCACCCTTCTCATTCCGGGACACCCTCGAAAAACCACACGTGCGTCTGACAT
TCGACTCGCAGACACGCATCTGGCCTACTGCGCATCTAGTGGACGCTTGCAGCTTTTCGACGCCCACGGC
ACCGAACTCCTCCCCGCATACATGGGGTACATCACCGACCGAGGTCTGCCATTATCTACGCAGGCACTCA
TGCTCCTAGCACCACCTATGCATTGCTCTTTGGACTTTTTCCCGCGTACGAATTCAGAGATAACGCATCA
AGCGCGTCTGATGCTAGGAGACGCTGTCCTCGCGCGAGAAAGCTGGATCTTTCCTACTTCAAGCATCTTT
ATGAATATCCCGTGTCTCTTAGAGGAAGCCTTGGTATGGTGGCGCAGCTTTTCCCGGTATCAGGGTCTAC
CCGAGTGTGGAGTTCTGCGAACATTCGACGCCCACGGCGTTGTGGGCAAAGGACAGTTTTACAACTCCCA
GATCATGGGAACGATCACCAACCTCATACGTGCATTACGCAACGCTCACTACGGATGCGTCATTGAGGAA
TTCTTTCCTCTTGTTGGCGAGTCCGGCGTAGCACAGGAATACATAGTCACAGGAACACGCTCTTTGAAGG
AGGGTATCTAA
 Primer design

Protein Sequence:866 a.a.
>CULC809_01698|ThioFinder1213 Corynebacterium ulcerans 809
MTTISWKLLNEALVRSCSVPYEALRQLCDAPTDALLTADLDQRLRVDAALDALGSAARQDVAGCTHTVLR
HTLLDLKRAAHHHDVHKVRALLAKATSAGVRLPAGVTTAADTVITAAENVLSSEQLHKVLMSSKKREREC
LGKIARDLGVDSAVLAASVPAAKAIRKLSTDCAMSAKQLARAHRTALGYVIRSATRSVPFSALCAIAPSQ
LSRASLHSDETLAPTSVHTIARWNVYAMAQIFSAMKKDFGFIATLPVLVNPDALSEHGHCALPRCSVEYL
GHVGDRDLAVYREERRVVDSNGLFGKVMALAASAPQNHEYTCEQLAAELSARTGLSKAQTKCIVLDAIRI
SALVVPTLDLSPSTAVSEQPIVTHLARGSDKAVSAARLIARIAEECNAVASISDFDRRHTQILDIAHHLD
SLRRLVDPSMPMFHTHVYEDGVGKESTIPSSIADLCTALDWEALADLVDLLDVRQAERALFEEFVSAKFP
RGEICHDVPALVNSFVAEVLTPLRQIDIEAVDENDLKSTASLPLGKAWEWIRARRRFLAHVAALRSNAAG
PVDIRDLLIDHRPLVQSRRYPLRSLNAYVQQGDKAKIVINRTLGGPGFPWSRFAHAMPDSATRAWSELSD
YASDAGVKLVELTAGKVVSNLNAHPATYPTTLLIPGHPRKTTRASDIRLADTHLAYCASSGRLQLFDAHG
TELLPAYMGYITDRGLPLSTQALMLLAPPMHCSLDFFPRTNSEITHQARLMLGDAVLARESWIFPTSSIF
MNIPCLLEEALVWWRSFSRYQGLPECGVLRTFDAHGVVGKGQFYNSQIMGTITNLIRALRNAHYGCVIEE
FFPLVGESGVAQEYIVTGTRSLKEGI