Home 

Gene Symbol:  
CULC809_01697
Organism:  
Corynebacterium ulcerans 809
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1901897..1903381 [1], 1485 bp
Product Function:  
hypothetical protein
Product Locus:  
 AEG82229.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1485 bp
>CULC809_01697|ThioFinder1212 Corynebacterium ulcerans 809
ATGGATCGCCATACTGCAGATTTTTGGGCCACAACGGATAACGCTGCGACCGAATACACGCAGCTCATTC
TGGAGCGCAAAGAACATGGCATGGTCTTCCCTGCTCAAGGTCCTTTTTGGAACCATCAACCCTATCCCGC
AAAAATTGTTCCAGACGCCCCTCGTTTCCAGCTTCATACACACGCCATGTCCCCCACGGACATCGCTATT
GCGCAAGCGCTGGAGGATTCTCTGATCAGAACTCATCTGCGCGCAGAAGTCGACTGCAACTCGCCGACAA
GGACCCGATCTGAGGCGCAATCTTTTCAGTGGTCTCGGAATACAGCCTCAGGCGGAGGCTTATACCCAGT
GAACGTCTACAGATACAGCCCCGGAGATAACCACCTGCCCGCTGGCCTGTACTTATTCAACCCCATAACC
TGCCAATGGCAGCAGTTGAGGGCTGATTCCCCACGAGGCGAACACTCGCGTTCTGCCGGTGAGACCCTGC
TGGTTACCGTGGAGTTTTGGCGTTCAGCGTTTAAGTACGGTGACTTTGCGTATCAAGCGACCTCCGTGGA
TGTGGGGATCGTTGTCGCGGCGTTAGTCTCCCAACTGGATGCAGCTGTTGGGCCGGTGGCTATCGACTGG
TCACCCGACGAGCTTGCTCTCTCCGAATTCCTTGGTAGTGATCCCCTCGACGAGGCCATATATTGCACGA
TCACGCTGCCTAACGGCTCCCCTTCAGACACTGTTACCGCTGGCGCGCCATCAGCCGTTCTCCAGACCTC
TGCTCGTCTCGCGCACTCGGGAACGATGCCCGTACGTTTTCCCACCACTGTGGCTTTGCAAAAACAGCGG
CTCCGAGAAATGCAGAGTATGCGTGCGCCTTTTTCTACGGAAAGAATCGCCGCCCCGCCACCAGCAATAA
TCAAGCGAGGCTCCAGCTCTTTTGGGCGCTATTCTGGAGCTCCAATCGACGCGGGTGTGCTTACTCGCAT
GGTGCAACGCGGGCGTGCCACGGCCGCTTCACTCCTGGGAACCCCTCCTGAAACTGATTATTCCTCGGGT
ATCCAAGCAGCCGCGCTGTGTGTCAACGTCATGGGCTTAGCACATTCTCTTATAGCGGATAGTGAGACAT
ATCCTGCGGCGGCTCCTGCGCGCCCGTGTCCACAGCTTCCCGAGTTATTGCGCAACACCTATCTCCTGAA
AAACTACGACCCCCTGCGCAGCTCAGCCGTCTTAGTGCTGTGCGCAGATTTGCAGCGGGTAACCACTACT
TACGGTGCCTCTGGTTATCGGTGGGCATGTGCTGAGGTCGGGGCCTTTTGTCACGCTGTCTATGCTGTTG
CGGCACAGGAGCGGGTCTCTGTGGGCGCTGTGTTGGGCTTTGATGCTCAGTACCAGCGCAACTACCTCGG
TTTAGCGGATAATCTCATCCCGGTCCTCAACATCCTTGTGGGTGTGGATCGGCCTCACGCACGGTGGAGG
AACTCGTTACTATGA
 Primer design

Protein Sequence:494 a.a.
>CULC809_01697|ThioFinder1212 Corynebacterium ulcerans 809
MDRHTADFWATTDNAATEYTQLILERKEHGMVFPAQGPFWNHQPYPAKIVPDAPRFQLHTHAMSPTDIAI
AQALEDSLIRTHLRAEVDCNSPTRTRSEAQSFQWSRNTASGGGLYPVNVYRYSPGDNHLPAGLYLFNPIT
CQWQQLRADSPRGEHSRSAGETLLVTVEFWRSAFKYGDFAYQATSVDVGIVVAALVSQLDAAVGPVAIDW
SPDELALSEFLGSDPLDEAIYCTITLPNGSPSDTVTAGAPSAVLQTSARLAHSGTMPVRFPTTVALQKQR
LREMQSMRAPFSTERIAAPPPAIIKRGSSSFGRYSGAPIDAGVLTRMVQRGRATAASLLGTPPETDYSSG
IQAAALCVNVMGLAHSLIADSETYPAAAPARPCPQLPELLRNTYLLKNYDPLRSSAVLVLCADLQRVTTT
YGASGYRWACAEVGAFCHAVYAVAAQERVSVGAVLGFDAQYQRNYLGLADNLIPVLNILVGVDRPHARWR
NSLL