Home 

Gene Symbol:  
CULC809_01696
Organism:  
Corynebacterium ulcerans 809
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1900311..1901861 [1], 1551 bp
Product Function:  
hypothetical protein
Product Locus:  
 AEG82228.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1551 bp
>CULC809_01696|ThioFinder1211 Corynebacterium ulcerans 809
ATGACTACGCGCGTCGTCTACCTGCACTGCCCGGCGCGCAGTTTCCCAGCGCACGCCCTGCCTCCGCGTC
ATGAGCAGTGGATAGCAGTCCCCTCCGAGGTATGCAGGGTCTGCCTTAGCGCATGGGCAGATCGCACGGA
AGAGGCTGCGGACTGGGTTAAGGCTGCTAGAGTACCCGGCTTCATCAGATGTTGGCTGTCTGAGTGTGTG
CACTATGTCGAGCGCCCCCAAGGAGGCTGGAGACTAGCAGCTACTGATGCACAGTGCCTTTCCAGTTCTA
CGGTGTTTATTCCGCCAAGCCCGTGCTGCACTGAGCACCACGATTGTGCTGCTAACGCAGAGGTTTCCGA
TCTCACAGGGCCTGTGTTAGCACCGTGTGGGACGGGGCCGATCACGGAGATTCGCCGTCCTGGAATGGTG
GTTTCCCGTGGAACCATGCCTGCTGTGGGGTCTCGACCAGCATTCCATTGGAGTGGTCAGGCGCCGACCA
TTGCTGAGAGTCGAAAGCTAGCTCTTTACGAGGCCGTCGAGCGCGCATCCGCATGTGGGAATGAGGGAGC
GGGAGGCGTCGATACGCATATTCCCCACGTCCCTGCCACTGATTTTGGGGTGGACAACGAACGGTGGAAC
CGTTCTTACGATCACTGCCGCAATTGGACACGCGCTATTCGCCTGGGAGATGAAACCGCATGGGCAGTCC
CCACGGATATGGCATTTTTCTGGTCTGACGCACAAGCTCGTTTTTGCTTCGATTCCTCCAGCGGCGCCGC
GGTGGGGCGCACATGGGAGGACGCGGTGATGTCTGGGTTAGTAGAGGTCATTGAACGTGACGCTGTCCTG
GCCGTATGGCATGGTTCCATGACCGTCCCAGAGATCGATGTTGACTCGATCAATGATCGCACTTACCAGG
CAATGCTGCGGCATCTTCGCAGGCAAGGGCTGGTTATCCGCGCGTTTTACTGCCCGCTGACTGTAGGAGT
TCCTGCTGTTATTGCGGTATGCACGGATACTGAGCGCACTTTCCTCTGTGTTGGGGCAGCCGCCGCACCC
GATCCTTATGTCGCAGTACGCAAAGCTCTACGGGAGGTCATGGCGGATTATCCGCAGTCGCGTTTGCTTG
CTCGTGCACGGTTGTCAGACGCCGCCGCAGTGCGTGCGGACGGTTCCGGGGCAGCTCATCGCCTCAGCGT
TGCCGCTTCCGAGCTTATCGACGCCGCCGCTTTCCTCCTCCTGCCCCGTAAAGAGCTGCTCCGTGTCTCC
GACATCCCGGGGTGCCCTCGCTTGTCTCTCGTTGAGCTAGTCGAGCGTCTCAAAGCACATGGCTTTTACG
GCTATGTTGTCGACTTCACCCAGAGTTATCACCAAATGGTGGGGCTTTCAGCTGTCAAGGTTATTGTCCC
TGGTCTCTTGCCGCTGGAATATATCGGACAGCTGACCAGGGCATTGCATATGCCTAGGTTGAGGCAACAG
ATGACATGTTTTCGCGCTTTGGGCCTAGCCCCTCCCAGCTCACCTCCCCGTCTCAATCTTGTTCCGCACC
CGCTTCCCTAA
 Primer design

Protein Sequence:516 a.a.
>CULC809_01696|ThioFinder1211 Corynebacterium ulcerans 809
MTTRVVYLHCPARSFPAHALPPRHEQWIAVPSEVCRVCLSAWADRTEEAADWVKAARVPGFIRCWLSECV
HYVERPQGGWRLAATDAQCLSSSTVFIPPSPCCTEHHDCAANAEVSDLTGPVLAPCGTGPITEIRRPGMV
VSRGTMPAVGSRPAFHWSGQAPTIAESRKLALYEAVERASACGNEGAGGVDTHIPHVPATDFGVDNERWN
RSYDHCRNWTRAIRLGDETAWAVPTDMAFFWSDAQARFCFDSSSGAAVGRTWEDAVMSGLVEVIERDAVL
AVWHGSMTVPEIDVDSINDRTYQAMLRHLRRQGLVIRAFYCPLTVGVPAVIAVCTDTERTFLCVGAAAAP
DPYVAVRKALREVMADYPQSRLLARARLSDAAAVRADGSGAAHRLSVAASELIDAAAFLLLPRKELLRVS
DIPGCPRLSLVELVERLKAHGFYGYVVDFTQSYHQMVGLSAVKVIVPGLLPLEYIGQLTRALHMPRLRQQ
MTCFRALGLAPPSSPPRLNLVPHPLP