Home 

Gene Symbol:  
CULC22_01777
Organism:  
Corynebacterium ulcerans BR-AD22
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1952563..1953576 [1], 1014 bp
Product Function:  
hypothetical protein
Product Locus:  
 AEG84487.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1014 bp
>CULC22_01777|ThioFinder1244 Corynebacterium ulcerans BR-AD22
ATGCGCACAACCGACCCCTGGCTCGCTTTTCATATTTTTTATGGAGAAGATCCCTCTCTTTTGCTCCGCG
ACTGCCTACTGCCCTTTGCCCATACATGCGTGACAGAAGGCCTAGTACAACGGTTCTTCCATATGAATTA
CTGGTTGGAGGGCGCACATGTCCGCTTAAGGCTAGAGCTTTGCAATCCGGCAGATCGCGAGCACGTCATA
TGCGCAGCACATCAGGCTATCCAACCGTGGATTGACGCTCATCCTTCCAGCGCACCCCAACTGTCGCTGC
GCAATCCCGAAGGCTATCGGCGCCTCTTTGAACACGAGTACCCCATGTCCAGGTTCTCCGACTACATCGA
TCAGGATGGCCTGCCGCGCCTAGAACCAGATAACTGCATCCGAGAGCGCTACTACGAGCGTGAATATGAC
CGCTACGGCGGACGGATAGGGATGTCGCTTAGCCAAGATGTTTTTCAAACCTCGACATTGTTCGTCGAAA
AGCTTTTACACTCTGGCGTTTTAGAAGCACGTACCTCACGATTAGCCGCGGCCGCGCTAGGAATGATCTG
CACTGCGCATACGGTTTTGGATTCCGACGCATCCATAGGACGCTTTTGGGAAAGCTACCACGCAGGTTGG
ACCTCGTCTTTTTCTATGCCCACCAGCTACACCTCGCCCACGGCACAGCACAAAATCTCCGCTGAGGCTC
AGGCGCTCTCACGCGCAGCCACGCCATTTCGTGAAGCCTTACGCCGCGCCCCAGACGGCTCAGGTCTCCC
CGAACCCTATGCCACTTTCACTCAACACATGACGTCTGCAGTGGAGAAACTCCATGCGGCGCATGCCTCT
CACGAGCTTGATTTTGGTGATTCTGCGGCAGAGGCCGGCCACACGTGGAAAGAGAACTCCATTTTTCTTC
TGCGCTCTTATGTCCACATGACCAACAACAGGATGTCCGTCAATATCTCAGATGAAGCCTATTTAGCTTA
TTTACTGCACGCGTTATATCAGGAGGCAATATGA
 Primer design

Protein Sequence:337 a.a.
>CULC22_01777|ThioFinder1244 Corynebacterium ulcerans BR-AD22
MRTTDPWLAFHIFYGEDPSLLLRDCLLPFAHTCVTEGLVQRFFHMNYWLEGAHVRLRLELCNPADREHVI
CAAHQAIQPWIDAHPSSAPQLSLRNPEGYRRLFEHEYPMSRFSDYIDQDGLPRLEPDNCIRERYYEREYD
RYGGRIGMSLSQDVFQTSTLFVEKLLHSGVLEARTSRLAAAALGMICTAHTVLDSDASIGRFWESYHAGW
TSSFSMPTSYTSPTAQHKISAEAQALSRAATPFREALRRAPDGSGLPEPYATFTQHMTSAVEKLHAAHAS
HELDFGDSAAEAGHTWKENSIFLLRSYVHMTNNRMSVNISDEAYLAYLLHALYQEAI