Home 

Gene Symbol:  
CULC22_01776
Organism:  
Corynebacterium ulcerans BR-AD22
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1949963..1952563 [1], 2601 bp
Product Function:  
hypothetical protein
Product Locus:  
 AEG84486.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2601 bp
>CULC22_01776|ThioFinder1243 Corynebacterium ulcerans BR-AD22
ATGACAACCATTTCATGGAAGCTTCTTAATGAAGCCCTGGTTCGCAGCTGCAGTGTGCCGTATGAGGCGT
TGCGGCAGCTTTGCGACGCCCCCACCGACGCACTACTTACTGCCGATCTGGACCAGCGACTCCGCGTAGA
CGCGGCCCTTGATGCCCTTGGTTCTGCGGCCCGCCAGGACGTCGCGGGGTGTACACACACAGTGTTGCGC
CACACGCTACTCGATCTCAAGCGAGCTGCACACCACCATGACGTGCGCAAAGTTCGTGCGCTGCTGGCTA
AAGCTACATCCGCTGGTGTGCGGTTGCCTGCTGGCGTAACGACTGCCGCAGATACGGTGATCACTGCCGC
CGAAAACGTGCTGTCCTCAGAGCAGCTGCACAAGGTACTCATGAGTTCCAAGAAAAGAGAGCGCGAGTGC
CTCGGGAAGATCGCCCGTGACCAGGGAGTCGATTCAGCAGTACTGGCCGCATCAGTCCCAGCGGCAAAAG
CCATCCGGAACCTAGGTGCAGATTGTGCGATGTCTGCCAAGCAGCTAGCTCGTGCCCACCGCACCGCGCT
GGGATACGTGATCCGCAGCGCCACCCGGTCAGTACCGTTTTCCGCCCTGTGCGCAATCGCGCCGTCTCAG
TTGTCCCACGCCAGCCTGCACTCGGATGAGACTCTTGCCCCAACATCTGTGCACACTATTGCGCGTTGGA
ACGTCTACGCTATGGCTCAGATTTTCTCTGCTATGAAGAAGGACTTTGGTTTTATTGCCACACTTCCGGT
TCTGGTTAATCCTGACGCGTTATCAGAGCATGGTCACTGCGCACTGCCTCGGTGTTCTGTCGAATATCTA
GGGCACGTCGGCGACCGGGACTTGGCCGTTTACCGGGAGGAACGCCGAGTGGTCGATTCCAATGGACTAT
TTGGAAAGGTCATGGCCTTAGCCGCAAGTGCTCCCCAAAACCACGAATACACGTGTGAGCAGCTGGCCGC
AGAGCTCTCGGCGCGTACAGGTTTAAGCAAGGCACAAACAAAGTGCATTGTTCTCGATGCCATCCGAATT
TCGGCCTTAGTTGTTCCCACTCTCGATTTATCCCCGTCCACAGCGGTATCTGAACAGCCGATAGTTACGC
ACTTGGCACGTGGGTCGGACAAGGCCGTATCTGCTGCGCGTCTCATTGCCCGCATCGCGGAGGAATGCAA
CGCGGTGGCGTCGATAAGCGACTTTGACCGCAGGCACACTCAGATCCTAGATCTCGCGCACCACCTGGAT
AGCCTCCGGCGACTCGTCGATCCCAGCATGCCGATGTTCCATACCCATGTGTATGAGGATGGGGTCGGGA
AAGAATCGACGATTCCCTCCTCCGTCGCGGACTCGTGCACAGCCCTTGACTGGGAAGCTCTCGCAGACCT
AGTCGATCTGCTTGATGTGCGGCAGGCAGAACGCGCGTTGTTTGAGGAGTTTGTGTCCGCAAAATTCCCC
CGTGGGGAAATCTGCCACGATGTTCCGGCGCTGGTTAACAGTTTTGTCGCCGAGGTCCTCACGCCACTGC
GCCAAATTGATATTGAGGCAGTCGATGAAAATGACCTGAAGTCCACTGCATCTTTGCCGCTGGGTAAGGC
TTGGGAATGGATTCGTGCGCGGCGTCGCTTCCTGGCACACGTGGCAGCATTAAGAAGCAACGCCGCTGGC
CCCGTGGACATACGTGATCTCCTCATCGATCATCGCCCTCTTGTGCAATCACGTAGATATCCGCTTCGGT
CTTTGAACGCTTATGTTCAGCAAGGCGACAAAGCCAAGATCGTGATTAACCGGACACTTGGCGGGCCAGG
TTTTCCGTGGTCTCGGTTCGCGCATGCGATGCCAGATTCCGCAACACGTGCATGGTCCGAATTATCTGAT
TATGCGTCTGATGCGGGAGTGAAACTCGTCGAGCTGACAGCCGGAAAAGTCGTCTCCAACCTCAACGCGC
ATCCGGCTACCTATCCAACCACCCTTCTCATTCCGGGACACCCTCGAAAAACCACACGTGCGTCTGATAT
TCGACTCGCAGACACGCATCTGGCCTACTGCGCATCCAGTGGACGCTTGCAGCTTTTCGACGCCCACGGC
ACCGAACTCCTCCCCGCATACATGGGGTACATCACCGACCGAGGTCTGCCATTATCTACGCAGGCGCTCA
TGCTCCTAGCACCACCTATGCATTGCTCTTTGGACTTTTTCCCGCGTACGAATTCAGAGATAACGCATCA
AGCGCGTCTGATGCTAGGAGATGCTGTCCTCGCGCGAGAAAGCTGGATCTTTCCTACTTCAAGCACCTTT
ATGAATATCCCGTGTCTCTTAGAGGAAGCCTTGGTATGGTGGCGCAGCTTTTCCCGGTATCAGGGTCTAC
CCGAGTGTGGAGTTCTGCGAACATTCGACGCCCACGGCGTTGTGGGCAAAGGACAGTTTTACAACTCCCA
GATCATGGGAACGATCACCAACCTCATACGTGCATTACGCAACGCTCACTACGGATGTGTCATTGAGGAA
TTCTTTCCTCTTGTTGGCGAGTCCGGCGTAGCACAGGAATACATAGTCACAGGAACACGCTCTTTGAAGG
AAGGTATCTAA
 Primer design

Protein Sequence:866 a.a.
>CULC22_01776|ThioFinder1243 Corynebacterium ulcerans BR-AD22
MTTISWKLLNEALVRSCSVPYEALRQLCDAPTDALLTADLDQRLRVDAALDALGSAARQDVAGCTHTVLR
HTLLDLKRAAHHHDVRKVRALLAKATSAGVRLPAGVTTAADTVITAAENVLSSEQLHKVLMSSKKREREC
LGKIARDQGVDSAVLAASVPAAKAIRNLGADCAMSAKQLARAHRTALGYVIRSATRSVPFSALCAIAPSQ
LSHASLHSDETLAPTSVHTIARWNVYAMAQIFSAMKKDFGFIATLPVLVNPDALSEHGHCALPRCSVEYL
GHVGDRDLAVYREERRVVDSNGLFGKVMALAASAPQNHEYTCEQLAAELSARTGLSKAQTKCIVLDAIRI
SALVVPTLDLSPSTAVSEQPIVTHLARGSDKAVSAARLIARIAEECNAVASISDFDRRHTQILDLAHHLD
SLRRLVDPSMPMFHTHVYEDGVGKESTIPSSVADSCTALDWEALADLVDLLDVRQAERALFEEFVSAKFP
RGEICHDVPALVNSFVAEVLTPLRQIDIEAVDENDLKSTASLPLGKAWEWIRARRRFLAHVAALRSNAAG
PVDIRDLLIDHRPLVQSRRYPLRSLNAYVQQGDKAKIVINRTLGGPGFPWSRFAHAMPDSATRAWSELSD
YASDAGVKLVELTAGKVVSNLNAHPATYPTTLLIPGHPRKTTRASDIRLADTHLAYCASSGRLQLFDAHG
TELLPAYMGYITDRGLPLSTQALMLLAPPMHCSLDFFPRTNSEITHQARLMLGDAVLARESWIFPTSSTF
MNIPCLLEEALVWWRSFSRYQGLPECGVLRTFDAHGVVGKGQFYNSQIMGTITNLIRALRNAHYGCVIEE
FFPLVGESGVAQEYIVTGTRSLKEGI