Home 

Gene Symbol:  
CULC22_01775
Organism:  
Corynebacterium ulcerans BR-AD22
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1948482..1949966 [1], 1485 bp
Product Function:  
hypothetical protein
Product Locus:  
 AEG84485.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1485 bp
>CULC22_01775|ThioFinder1242 Corynebacterium ulcerans BR-AD22
ATGGATCGCCATACTGCAGATTTTTGGGCCACAACGGATAACGCTGCGACCGAATACACGCAGCTCATTC
TGGAGCGCAAAGAACATGGCATGGTCTTCCCTGCTCAAGGTCCTTTTTGGAACCATCAACCCTATCCCGC
AAAAATTGTTCCAGACGCCCCTCGTTTCCAGCTTCATACACACGCCATGTCCCCCACGGACATCGCTATT
GCGCAAGCGCTGGAGGATTCTCTGATCAGAACTCATCTGCGCGCAGAAGTCGACTGCAACTCGCCGACAA
GGACCCGATCTGAGGCGCAATCTTTTCAGTGGTCTCGGAATACAGCCTCAGGCGGAAGCTTATACCCAGT
GAACGTCTACAGATACAGCCCCGGAGATAGCCACCTGCCCGCTGGCCTGTACTTATTCAACCCCATAACC
TGCCAATGGCAGCAGCTGAGGGCTGATTCCCCACGAGGCGAACGCTCGCGTTCTGCCGGTGAGACCCTGC
TGGTTACCGTGGAGTTTTGGCGTTCAGCGTTTAAGTACGGTGACTTTGCGTATCAAGCGACCTCCGTGGA
TGTGGGGATCGTTGTCGCGGCGTTAGTCTCCCAACTGGATGCAGCGGTTGGGCCGGTGGCTATCGACTGG
TCACCCGACGAGCTTGCTCTCTCCGAATTCCTTGGTAGTGATCCCCTCGACGAGGCCATATATTGCACGA
TCACGCTGCCTAACAGCTCCCCTTCAGACACTGTTACCGCTGGCGCGCCATCAGCCGTTCTCCAGACTGC
TGCTCGACTCGCACACTCGGGAACGATGCCCGTACGTTTTCCCACCACTGTGGCTTTGCAAAAACAGCGG
CTCCGAGAAATGCAGAGTATGCGTGCGCCTTTTTCTACGGAAAGAATCGCCGCCCCGCCACCAGCAATAA
TCAAGCGAGGCTCCAGCTCTTTTGGGCGCTATTCCGGAGCTCCAATCGACGTGGGTGTGCTTACCCGCAT
GGTGCAACGCGGGCGCGCCACGGCCGCTTCACTCCTGGGAACCCCTCCTGAAACCGATTATTCCTCGGGT
ATCCAAGCAGCCGCGCTGTGTGTCAACGTCATGGACTTAGCACATTCGCTTATAGCGGATAGTGAGACAT
ATCCTGCGGCGGCTCCTGCGCGCCCGTGTCCACAGCTTCCCGAGTTATTGCGCAACACCTATCTCCTGAA
AAACTACGACCCCCTGCGCAGCTCAGCCGTCTTAGTGCTGTGCGCAGATTTGCAGCGGGTAACCACTACT
TACGGCGCCTCTGGTTATCGGTGGGCATGTGCTGAGGTCGGGGCCTTTTGTCACGCTGTCTATGCTGTTG
CGGCACAGGAGCGGGTCTCTGTGGGCGCTGTGTTGGGCTTTGATGCTCAGTACCAGCGCAACTACCTCGG
TTTAGCGGATAATCTCATCCCGGTCCTCAACATCCTTGTGGGTGTGGATCGGCCTCACGCACGGTGGAGG
AACTCGTTACTATGA
 Primer design

Protein Sequence:494 a.a.
>CULC22_01775|ThioFinder1242 Corynebacterium ulcerans BR-AD22
MDRHTADFWATTDNAATEYTQLILERKEHGMVFPAQGPFWNHQPYPAKIVPDAPRFQLHTHAMSPTDIAI
AQALEDSLIRTHLRAEVDCNSPTRTRSEAQSFQWSRNTASGGSLYPVNVYRYSPGDSHLPAGLYLFNPIT
CQWQQLRADSPRGERSRSAGETLLVTVEFWRSAFKYGDFAYQATSVDVGIVVAALVSQLDAAVGPVAIDW
SPDELALSEFLGSDPLDEAIYCTITLPNSSPSDTVTAGAPSAVLQTAARLAHSGTMPVRFPTTVALQKQR
LREMQSMRAPFSTERIAAPPPAIIKRGSSSFGRYSGAPIDVGVLTRMVQRGRATAASLLGTPPETDYSSG
IQAAALCVNVMDLAHSLIADSETYPAAAPARPCPQLPELLRNTYLLKNYDPLRSSAVLVLCADLQRVTTT
YGASGYRWACAEVGAFCHAVYAVAAQERVSVGAVLGFDAQYQRNYLGLADNLIPVLNILVGVDRPHARWR
NSLL