Home 

Gene Symbol:  
CULC22_01774
Organism:  
Corynebacterium ulcerans BR-AD22
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1946896..1948446 [1], 1551 bp
Product Function:  
hypothetical protein
Product Locus:  
 AEG84484.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1551 bp
>CULC22_01774|ThioFinder1241 Corynebacterium ulcerans BR-AD22
ATGACTACGCGCGTCGCCTACCTGCACTGCCCGGCGCGCAGTTTCCCAGCGCACGCCCTGCCTCCGCGTC
ATGAGCAGTGGATAGCGGTCCCCTCCGAGGTGTGCAGGGTCTGCCTTAGCGCATGGGCGGATCGTACGGA
AGAGTCTGCGGACTGGGTTAAGGCTGCTAGAGTACCCGGCTTCATCAGACGCTGGCTGTCTGAGCGTGTG
CACTATGTCGAGCGCCCCTTGGGAAGCTGGAGACTAGCAGCTACTGATGCACAGTGCCTCTCCAGTTCTA
CGGTGTTTATTCCGCCAAGCCCGTGCTGCACTGAGCACCACGATTGTGCTGCTAACGCAGAGGTTTCCGA
TCTCACAGGGCCTGTGTTAGCACCGTGTGGGACGGGGCCGATCACGGAGATTCGCCGTCCTGGAATGGTG
GTTTCCCGTGGAACCATGCCTGCCGTGGGATCTCGCCCAGCATTCCATTGGAGCGGTCAGGCACCGACTA
TTGCTGAGAGCCGAAAGCTAGCTCTTTACGAGGCCGTCGAGCGCGCATCCGCATGTGGGAATGAGGGAGC
GCGAGGCGTCGATACGCATATTCCCCACGTCCCTGCCACTGATTTTGGGGTGGACAACGAACGGTGGAAC
CGTTCTTATGAACGCTGCCGCAATTGGACACGCGCTATTCGCCTGGGAGATGAAACCGCATGGGCAGTCC
CCACGGATATGGCGTTTTTCTGGTCTGACGCACAAGCTCGTTTTTGCTTCGATTCCTCCAGCGGCGCCGC
GGTGGGGCGCACATGGGAGGACGCGGTGATGTCTGGGTTAGTAGAGGTCATTGAACGTGACGCTGTCCTG
GCCGTATGGCATGGTTCCATGACCGTCCCAGAGATCGATGTTGACTCGATCAATGATCGCACTTACCAGG
CAATGCTGCGGCATCTTCACAGGCAAGGGCTGGTTATCCGCGCGTTTTACTGCCCGCTGAGTGTAGGAGT
TCCTGCTGTTATTGCGGTATGCACGGATACTGAGCGCACTTTCCTCTGCGTTGGGGCAGCCGCCGCACCC
GATCCTTATGTCGCAGTACGCAAAGCTCTACGGGAGGTCATGGCGGATTATCCGCAGTCGCGTTTGCTTG
CTAGTGCACGGTTGTCAGACGCCGCCGCAGTGCGTGCGGACGGTTCCGGGGCAGCTCATCGCCTCAGCGT
TGCCGCTTCCGAGCTTATCGACGCCGCCGCTTTCCTCCTCCTGCCCCGTAAAGAGCTGCTCCGTGTCTCC
GACATCCCGGGGTGCCCTCGCTTGTCTCTCGTTGAGCTAGTCGAGCGTCTCAAAGCACATGGCTTTTACA
GCTATGTTGTCGACTTCACCCAGAGTTATCACCAAATGGTGGGGCTTTCAGCTGTCAAGGTTATTGTCCC
TGGTCTCTTGCCGCTGGAATATATCGGACAGCTGACCAGGGCATTGCATATGCCTAGGTTGAGGCAACAG
ATGACATGTTTTCGCGCTTTGGGTCTAGCCCCTCCCAGCTCACCTCCCCGTCTCAATCTTGTTCCGCACC
CGCTTCCCTAA
 Primer design

Protein Sequence:516 a.a.
>CULC22_01774|ThioFinder1241 Corynebacterium ulcerans BR-AD22
MTTRVAYLHCPARSFPAHALPPRHEQWIAVPSEVCRVCLSAWADRTEESADWVKAARVPGFIRRWLSERV
HYVERPLGSWRLAATDAQCLSSSTVFIPPSPCCTEHHDCAANAEVSDLTGPVLAPCGTGPITEIRRPGMV
VSRGTMPAVGSRPAFHWSGQAPTIAESRKLALYEAVERASACGNEGARGVDTHIPHVPATDFGVDNERWN
RSYERCRNWTRAIRLGDETAWAVPTDMAFFWSDAQARFCFDSSSGAAVGRTWEDAVMSGLVEVIERDAVL
AVWHGSMTVPEIDVDSINDRTYQAMLRHLHRQGLVIRAFYCPLSVGVPAVIAVCTDTERTFLCVGAAAAP
DPYVAVRKALREVMADYPQSRLLASARLSDAAAVRADGSGAAHRLSVAASELIDAAAFLLLPRKELLRVS
DIPGCPRLSLVELVERLKAHGFYSYVVDFTQSYHQMVGLSAVKVIVPGLLPLEYIGQLTRALHMPRLRQQ
MTCFRALGLAPPSSPPRLNLVPHPLP