Home 

Gene Symbol:  
HMPREF9176_0867
Organism:  
Streptococcus downei F0415
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
128482..129396 [-1], 915 bp
Product Function:  
thiopeptide-type bacteriocin biosynthesis domain protein
Product Locus:  
 EFQ57258.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:915 bp
>HMPREF9176_0867|ThioFinder1278 Streptococcus downei F0415
ATGAAAGAAATTGAAAAGTGGTTATCCTACCATATTTTTTGTCATAATCTGATGCACCACGACAGTATTA
TCTGCACTCTAAATAATTGGGCATCCAAAGAAGGGCTTACATGCTTTTTCTTCATTCGCTATTGGGAAGG
TGGACCCCATATTCGTTTTCGGATAAAGACTGCAGAATCTTCCAATAAAGATTATTACCAAATCCTATCG
GATTTATTAGACCCAGAACTCTCTAGTTCTAATGTAAATGTAACATTAACAAAAGAGCAATACTATAAGG
GACATAAGTTAGACGGGGAAAAAATTCCGTTGAAAAATTTGCCTTGGTATAACAATAATTCTATTGTCTC
AATACCGTATGTTCGAGAAAATGAGCGATACGGAGGCTATGAGGTAATAGAGAAAGCAGAGTCTGTTTTC
TATCATTCTAGCCAATTAGTATCTACTATGTTGGAAGGTTGTATGAATTGTCACGTGATGATTCGAATGC
TTTTTTACATCTATACTTATGAGCAAGTAAAGACAGCTATTACAGATAAGAAAATTGATTTTGACTTTGA
ACAATTTTATGCTAATTGTTTCTCTTATTGGAACAAATTGTATGACTTGAAGAATGAAAGTTATATTGCG
GACATTATCACTTCCATAGAACATTCATTTGAAGGGAAAGAAGAAAAAATTAAGACAGTCTTCTCATTCA
TTAAACCAGAAATGAGGGATTCATTTATTACAAATTTAATTGAATATTTGGAGGAAGTCTATCAACTTAG
AGGCAAGAAAATGATGCGGTCAGTTCTCTTTTCTCAGATGCACATGTTTGCAAACCGCCTTGGCATTCCT
ATTGAATATGAATGTGCCATCTATGGATACTATCACACGAAAACATCAACGGCAACTTCCCGGAAAGGAG
TATAA
 Primer design

Protein Sequence:304 a.a.
>HMPREF9176_0867|ThioFinder1278 Streptococcus downei F0415
MKEIEKWLSYHIFCHNLMHHDSIICTLNNWASKEGLTCFFFIRYWEGGPHIRFRIKTAESSNKDYYQILS
DLLDPELSSSNVNVTLTKEQYYKGHKLDGEKIPLKNLPWYNNNSIVSIPYVRENERYGGYEVIEKAESVF
YHSSQLVSTMLEGCMNCHVMIRMLFYIYTYEQVKTAITDKKIDFDFEQFYANCFSYWNKLYDLKNESYIA
DIITSIEHSFEGKEEKIKTVFSFIKPEMRDSFITNLIEYLEEVYQLRGKKMMRSVLFSQMHMFANRLGIP
IEYECAIYGYYHTKTSTATSRKGV