Home 

Gene Symbol:  
HMPREF9176_0871
Organism:  
Streptococcus downei F0415
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
132678..135197 [-1], 2520 bp
Product Function:  
lantibiotic dehydratase, C-terminal domain protein
Product Locus:  
 EFQ57225.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2520 bp
>HMPREF9176_0871|ThioFinder1282 Streptococcus downei F0415
ATGGTTAAAAATATATATTATAGAAAAACAAACTTTCCAAATAGAGAATTTTCTAAGATTTTCCAAAAAG
AGGTTTTTCAAACGTTACGCACTTATCAGTTTGAATACTCTCATTTAGTGGAACAGTTAGAATCGACCCA
TGAAACTGGAATCGAAGAACTAAATCAGGTGATTCAAGATTTTCCAGAAAGCAAAAATAAACAACAACTA
CTTAAATTTTCACATGATTTTTACAATAATCGCGGTGAGTTAGCCAATAAATATCATAAAATATCCTCAC
TGCTTCCGTCTAAACTGACCACTATCTTTGATTCTTATTTTGAATATCAAAGACAAACTGTCGAGAATGA
AGACAAGGTTGAAAAGCTGGTTCATCAACAGTATCTAAATGAGAAACAGTTAATCATGGCAGGTTTATCT
AAACATCCTGATTTTGTTAAAAATACGAAAATGATTGACCAAACTCTTTATCAAAAAATAAAAAAATTAC
TTAAAACAGATGTTGAAAAACACAATAAAAAGCAACGTCAAATGGATGTTTTTTTGTATAACTACTATAC
TCGCATCGCTACTAAAACAAGTCCACTAGGTTTATTGGGGACAACTGGTGTATACGGACGAGAGCCGTTT
GATTTAAAGAAAAACATCGTTATGTCGGTGAATTCTTCTATTATTTTAAAACTATTTGATCGGATTTATC
TAAATCCAAATTATCAGCCAAACTTAACATTTAAACTAAATGAGACTCTTATCCATAAAGATGGGAAATA
TTATATTACAGTATTTAATGATGTGGCAGGGAAAAGTCTCTATCGTAACCGCCAAGAATTAGTTACTCTT
TCTGAAAATGAGAGTTTAAATGGGATTCTAACTCTATTTAAGGGCCAAAAAGTGTTAACAGGGCGCACTC
TTCTGAAATACTTGTCACAAAATTCTCAAGAGGAATATCTACCAAAATTGTTGGAAAACAGTGTATTACT
TCCAGCAGAACAGATTAATATTGTCGGAAAGCAAAGTATTTCAAAAGCCCTGCTTGAAAAATTAAAAGAG
GTTTCCTCGGAATTATTCTCAGATGAGATTGCAATATTAGAAAAAGCAGTTGCCCTAGAAAATGAAGTAT
TTTCTTGGACGGCTTATGATCAATTGACGGAAGAAATTCACAATATTGTTCAAACTTACGGTATAGAAGG
TTTTAATAAGTCTACTTACGTTTCAATTGATGCGGTTACATCGCAAAATGGCACTTATTTGGAAGAACAG
GCCAAAGTTGTAAAAGAAAACCAGAGAATTATTGAAGACTTATCAAAATTTATTTCTATTTTTGATATTT
CAACTCGTAGTAAATATCTAGCTTATGAAATGCTCAAAACAAATTACGGGGGAGAGTTTATTCCTCAAAA
TACGAGAGAAATAAGTAAATTTTTACGAGATTTGGCAGCAACACTTTTTCAAAGGGATGGCTATTGGATG
GAATCTTTTGGATACTTAGGGACTTCCTACGACCATCAAATTGACAACCGGCTCTTGAAATTAAAGAAGA
GTATAGTGCAGCAATTATTAGTACAAGATTTGGAAGATGGTTCGGATCTCTTGATTTCACATGAATTATT
GAAAGATTCTACGACGCAATTAGAAAACCTAGTAGGTCAGAACCATAAGTCCCGTGGTTACTTTTTACAA
GTGAGTCCAGAAAATAAAATTGTTTTCAACCATATCTATAAAGGCTATGGAGTCTATCGCAGAAGATTCA
ATCATTATCTTCCGACAGAAATGGAGCCTTATGGACTAGATGGAGAGTTAGTGGACATTCCGATGACGTT
TGGCTTTAATGCAAATATTCGAGAAAGTACGGATAAAACCTTGCATTTGCCGTTGGGAGACTTGACTTTG
ACAAGTCCTAAACAGTTGACGTGGTTAGACTTGGGCTTTAGACTTTCAACAGGATCAAAAGAGATTGAAG
TATTTGAGAAGACAACAGGAAATATTGTGTATCCGCATTTCTTAGGTAGTTTGATTACTGTTGCGCTTCC
ATCGTTAGTCGCAGTGTTTAATTCTATTACTCTTAATGATTCCATTTATTTTGATTTTGGGGAACTGTTA
TTAAGACAAAAGCTAGAAGAAAGTTCGCAAGAAAAGGTAGTATTACCTAGACTTTGCTTTGAAAATACAA
CTTTGATTTTATCTAGAAAAAAATGGTACCTCACTTGTAAGGCCCTACATGCGATTCTTGATAAAGATAG
TTCAATGGGTAGAAAATGGCTAGAAGTAGTTGAATATTTTGAACAAGAAGGGTTACCGTTATCTTTCTTT
ATTAAAGATTTTTTTGAAAGCTACGATCAAGATTCAGAATTGTTAAAAACGAAACCACTCTACATTAATT
TTGAATCTTTCTTGAGTTTTAAGGCTTTTGCTGGTTTGTTGAAAAAGAAGGATAAGATTTTAATTGAAGA
AACTTTACCGGAATGTATTAATACGGAAACAGATACAATTATAGAATTGATTGTTGAAACAGATGACTAA
 Primer design

Protein Sequence:839 a.a.
>HMPREF9176_0871|ThioFinder1282 Streptococcus downei F0415
MVKNIYYRKTNFPNREFSKIFQKEVFQTLRTYQFEYSHLVEQLESTHETGIEELNQVIQDFPESKNKQQL
LKFSHDFYNNRGELANKYHKISSLLPSKLTTIFDSYFEYQRQTVENEDKVEKLVHQQYLNEKQLIMAGLS
KHPDFVKNTKMIDQTLYQKIKKLLKTDVEKHNKKQRQMDVFLYNYYTRIATKTSPLGLLGTTGVYGREPF
DLKKNIVMSVNSSIILKLFDRIYLNPNYQPNLTFKLNETLIHKDGKYYITVFNDVAGKSLYRNRQELVTL
SENESLNGILTLFKGQKVLTGRTLLKYLSQNSQEEYLPKLLENSVLLPAEQINIVGKQSISKALLEKLKE
VSSELFSDEIAILEKAVALENEVFSWTAYDQLTEEIHNIVQTYGIEGFNKSTYVSIDAVTSQNGTYLEEQ
AKVVKENQRIIEDLSKFISIFDISTRSKYLAYEMLKTNYGGEFIPQNTREISKFLRDLAATLFQRDGYWM
ESFGYLGTSYDHQIDNRLLKLKKSIVQQLLVQDLEDGSDLLISHELLKDSTTQLENLVGQNHKSRGYFLQ
VSPENKIVFNHIYKGYGVYRRRFNHYLPTEMEPYGLDGELVDIPMTFGFNANIRESTDKTLHLPLGDLTL
TSPKQLTWLDLGFRLSTGSKEIEVFEKTTGNIVYPHFLGSLITVALPSLVAVFNSITLNDSIYFDFGELL
LRQKLEESSQEKVVLPRLCFENTTLILSRKKWYLTCKALHAILDKDSSMGRKWLEVVEYFEQEGLPLSFF
IKDFFESYDQDSELLKTKPLYINFESFLSFKAFAGLLKKKDKILIEETLPECINTETDTIIELIVETDD