Home 

Gene Symbol:  
HMPREF9176_0866
Organism:  
Streptococcus downei F0415
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
127669..128481 [-1], 813 bp
Product Function:  
SagB-type dehydrogenase domain protein
Product Locus:  
 EFQ57228.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:813 bp
>HMPREF9176_0866|ThioFinder1277 Streptococcus downei F0415
ATGAAAAAAGTATTGTTAAATGAAGAAATGTATTACACTCCTAATTTTGATTATGAGCAATTAAAAAATC
GTCGAAAGAAATTTGCGACTAATCGTATTAATTGGTTTATGAACAATAGTCCAAAACAAGATTATCAATT
TCCAAAAGATAATATTACAGACTTTGATAATAGGAAACAATATGATTACTACCAAGAAGATGTTAAAGAG
GATCCAATTCGAAAATTATTTGAGAATCGACGGTCAACCCTTTTAAACTCTTTTGAGGGGAAATGGAATC
GCGAAGAATTATTTGAGTTATTGACAATCGCTGTCGGCCCAAATCCACGAAAAAGGGTATATCATGGGGA
GGATTTAATCCTAAGAAATTATCCTTCAGGAGGTGCGCTATTTCCAGTAAAACTCTATATTTTTGTCAAA
GATGTTGAGGGAGTTGAAACAGGAGTTTATTACATCAGTCCTCAGTTGAAAAAATTAGTCAAAGTAGAAA
ATAAAAAAGAGATGATATGGGATAATCTCTTCCCGATGACTCTTTACAAACTAGATGCACTTAGTAACTC
AACAGAAAAACTTAGTTTTGCTGTATTCATGGTAGTTGACTTTAAGGAATCATTTAAAAAATACGGTGAG
TTGTCTGAGCGTTTAGCCTTCTTCGAAGCAGGACATGTCGGACAAAATCTGCAACTCGTTTCTAGCCACC
TCAATAAAAAGTCACTTCCCGTTTGTGGTCTCTTTCCTGAAGAGGTTGAAAAACAAATTGGAATTCAAAA
CAGTGACACGGAATATTGTATCTATGGAATATTATTTGGATAA
 Primer design

Protein Sequence:270 a.a.
>HMPREF9176_0866|ThioFinder1277 Streptococcus downei F0415
MKKVLLNEEMYYTPNFDYEQLKNRRKKFATNRINWFMNNSPKQDYQFPKDNITDFDNRKQYDYYQEDVKE
DPIRKLFENRRSTLLNSFEGKWNREELFELLTIAVGPNPRKRVYHGEDLILRNYPSGGALFPVKLYIFVK
DVEGVETGVYYISPQLKKLVKVENKKEMIWDNLFPMTLYKLDALSNSTEKLSFAVFMVVDFKESFKKYGE
LSERLAFFEAGHVGQNLQLVSSHLNKKSLPVCGLFPEEVEKQIGIQNSDTEYCIYGILFG