Home 

Gene Symbol:  
HMPREF9176_0868
Organism:  
Streptococcus downei F0415
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
129403..131082 [-1], 1680 bp
Product Function:  
YcaO-like family
Product Locus:  
 EFQ57268.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1680 bp
>HMPREF9176_0868|ThioFinder1279 Streptococcus downei F0415
ATGAAAACGAAATTAATTACCAATGATTCATTTTTTGATGAGAACCATTTGCAGATTTTGGAAGGTGGAA
GGAAGTACGCTATCTTGGTGGTGGACCGTATCTTTTTCTTCACAAAGGAAGAGGGCTTTCTTGAGGACTT
TTTATACACCGTTACTTTATATCAAGAGGCTAAAACAAAAAATTTACTGACCAGTATGTTTTCAGCAAAA
TACCAGAATAGTGAATCAGCAAAAAACTCGGCAAAAGCTCTCCTAGACCAACTTGTTTTTAAGACAGGAC
AGGTTGGGACATTAGATTTAGAACAACAAAAAGTATCTTATTTTCATATTAAAAAGAGGAGAAGTGCTCA
TACAAGAAGTCAGTTAGGATTTAACCAGCTATTGGCAAAAAAAGATATTGAGAGGTCAACTGGCTTTCGA
GCAAAAACTATTGGAGACTTATCCAAGAATGCACAATGTTTTTTGGATACAACAGTGGCCTATCGTAAAT
TCTTTGATTTGGATTCAGATTATTTTCCAGGTGTAGGGATTGAATATGCTGTAACAGATAAATATATAGA
GTGTGGTTATGGTCGTTCTTCATCATTTCAAGATTCGACCAACATTGCTCAGTTAGAAGCCATTGAGAGG
TACTCCTCCCTGTATTATCCATACAAAACCAAGGATATATATGGGAAGTTTTCAGATTTACCAGATGCTG
TTCATCCTGAGAAATTCATACTACCTTCCTCTGATAAAAATCCATTTATGCCTTATCGAAATAATTTGGA
AATCTATTGGACAGAGGCAGAGTCTTTGAAAAAGAAGAAAACGGTATTGATTCCTGAACAATTAGCAGTA
TATGGCGATTCTTTCTTTAGAGATAAAAAGAAGCAACATCGCTTTATTTATGATAGTTCGAATGGTGTTG
CTTTAGGAGGAACCTTTGAGGAAGCAATTCTGTATGGGATTTTGGAACTAATTGAGAGAGATAACTTTTT
AACAACTTGGTATGGACGAATCCCAGTCGAAGAGGTAACAATAGAATCTCTGGGCTTGTCTGAGGATACT
CTGAAGACAATTCGTTGTGCTCAACAAGATGGCTTTGATATCAGAGTTTTTGATATTTCAATGGAGTTAG
GCGTTCCTTCCTTTTGGGCTTTGGTAAGAAGTTTGAAAGACCATAAGATGTATGCCTACACAGCAGCAGG
AAGTAATCCTCTCCCTCACAAGGCAGCAGAATCAGCACTGTTAGAGGCGTTAGTTGGAATTAAAATTCAC
GATAATATCAATGCCGAATTTGGAATGAAGGTTCCTACCGAAGTTACTGAAATGGAAGACCATGTGAACT
ACTATTCTAGTAATCAGCACAAAACAGCATTCGATTTTTTAAAGGCATCTCATGTAACCGACTTATCACC
ACAAAAATATATTCAAGAAAATAATACAAAGTCATACTTGCGAGTATTGATTCAACGAGTACTAAAAAAA
TATGAAGATATTTACGTGGTCAATTTGACTTCAAAAGAAATGGAAGAACTTGGCATCTATACTGTGAAAG
TAATTGTGCCAGGGTTACTCCCTATAACTTTTGGAGTACAAAATGAACGAGTTTCTATGAGTCGTATCAA
TCAAGAAAGGAGTAGGAGAGGTCTTGAGGAAGTGAGGCTAGTCAACCCATATCCCCATCCCTTCCCATAA
 Primer design

Protein Sequence:559 a.a.
>HMPREF9176_0868|ThioFinder1279 Streptococcus downei F0415
MKTKLITNDSFFDENHLQILEGGRKYAILVVDRIFFFTKEEGFLEDFLYTVTLYQEAKTKNLLTSMFSAK
YQNSESAKNSAKALLDQLVFKTGQVGTLDLEQQKVSYFHIKKRRSAHTRSQLGFNQLLAKKDIERSTGFR
AKTIGDLSKNAQCFLDTTVAYRKFFDLDSDYFPGVGIEYAVTDKYIECGYGRSSSFQDSTNIAQLEAIER
YSSLYYPYKTKDIYGKFSDLPDAVHPEKFILPSSDKNPFMPYRNNLEIYWTEAESLKKKKTVLIPEQLAV
YGDSFFRDKKKQHRFIYDSSNGVALGGTFEEAILYGILELIERDNFLTTWYGRIPVEEVTIESLGLSEDT
LKTIRCAQQDGFDIRVFDISMELGVPSFWALVRSLKDHKMYAYTAAGSNPLPHKAAESALLEALVGIKIH
DNINAEFGMKVPTEVTEMEDHVNYYSSNQHKTAFDFLKASHVTDLSPQKYIQENNTKSYLRVLIQRVLKK
YEDIYVVNLTSKEMEELGIYTVKVIVPGLLPITFGVQNERVSMSRINQERSRRGLEEVRLVNPYPHPFP