Home 

Gene Symbol:  
BFZC1_19170
Organism:  
Lysinibacillus fusiformis ZC1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
92912..93574 [1], 663 bp
Product Function:  
hypothetical protein
Product Locus:  
 EFI66951.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:663 bp
>BFZC1_19170|ThioFinder1314 Lysinibacillus fusiformis ZC1
ATGTGGAGAAGTTACCATATTTACACAAGTAACCGTAAAATGTTTTTACAAATTTTAGATAACCTACAAA
ATGAATATTATAATAGTAAGTTTTTCTTTGTCCAATATGTAGACCCAATAGGTTTTCATTTTCGATTACG
TGTCCAAAGTGTTGAGCAACAAAATATAGAGCTAAAAATCAACGAATATTTTGGGAATATCCGTATTCTA
AAAAAGGTTTATGATCCTGAATACACGTTATTTATGGATTCACTACCAATCTATGAGGAATACTCAGTTG
AGTTAACTAAATTTCTAGTTAGTTATCGGGATATTCCGCCACATTCCTATATAGAAGATATTATAAAAAT
GCTCTTAGAACATTTCAGATGTAATAACATTAATTTTATTCAATTTTATATGTCTTATTGGCAAGGATAT
GCTCGTTTTCAAAATAAAACTCAGCAAGAAAATTTACGGCAACAGTTAAGTAGAAGTCTTGAGAGCCCCC
CATTTACTAATGTAATTTCAATTTTATACCCATTAGAGGAACAGCATTTAAACAAAGAAATTTGTTTTAA
ATTTTTACATATGACTTTGAATAAATTTGGATTCAGTATTATGGATGAGCTTGTCATTCTATCTAATTAT
TTAGAGCAACACACAATTAGTCCACAGAAATAG
 Primer design

Protein Sequence:220 a.a.
>BFZC1_19170|ThioFinder1314 Lysinibacillus fusiformis ZC1
MWRSYHIYTSNRKMFLQILDNLQNEYYNSKFFFVQYVDPIGFHFRLRVQSVEQQNIELKINEYFGNIRIL
KKVYDPEYTLFMDSLPIYEEYSVELTKFLVSYRDIPPHSYIEDIIKMLLEHFRCNNINFIQFYMSYWQGY
ARFQNKTQQENLRQQLSRSLESPPFTNVISILYPLEEQHLNKEICFKFLHMTLNKFGFSIMDELVILSNY
LEQHTISPQK