Home 

Gene Symbol:  
BFZC1_19165
Organism:  
Lysinibacillus fusiformis ZC1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
90789..92912 [1], 2124 bp
Product Function:  
hypothetical protein
Product Locus:  
 EFI66950.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2124 bp
>BFZC1_19165|ThioFinder1313 Lysinibacillus fusiformis ZC1
ATGAAGGATACAATTTGTATGAAAAGAAAGACTTTGTTTAAAACAGAACGCTTAGATGATTTAAAAGATG
AACCATTGAAGATGTATTCGAATTGGAATAATTATAAAGAAAATCTTGAAAAGATTAAAAAACAATTGTT
AAAGATGTTGAATGAAAAAACAGAAATACTTTACATAAATAAGAATTTGAAAGAGATGAAATCGTATTTA
AATATAAAAAAAACTCTAAAAAAAGAACGCATTATTCGTGAAGCGATTTTAGATGAAATAGATGATAAAC
AAATTAAAGAGCATTCAAGAATCTATAATGAAACATTTGAGTTGATTAAGTCGATTGAAAAGCAAGTCGA
AGATGCATTTTTAAGAAAAGTAAATCGTTACGAATCATTTTTAACTCATTCTGAATTTCAACAAGCCCTG
TCAATTACAGCTTTTGAAGCATATGAACAACTTTTTAATCCAGAAATTACAAAAGACTCAGTAAACAGAG
CTCGATATCGTTTTATTCAGCGTGCCACTGTAAAAACTAGCCCACTTAGCTATTTAGGAAAAACTATATA
TTTAAGTGATGAAACTAAAATTACTGAACAAATTAAATTAAATAATGTAGTAAAATCTTTAATTTTAATG
GCTTCTCTTCATAATAAAAGTTTAGATCATTTATTACAAATTAAAGTAAGCCCTAAATTCAAAAAATGTA
ATGGAATGGATGCTGTCTATTTTGAAAAGAACTATTTATTAAAAGGTGTAGATTGGATACTTAAACAAGA
TGATATATTACACCAAAAAGAAGTCGTGGATTTTTTATCAAAAATACAGCATTGTGAAACCCCAGCAGAA
GTTAAGAGGGAAGTTAGTAACTGTGAAGAAATAACGTATGAAATGTTAATAAACAATGGCCTGGTTATAC
CTAATTTTAATTTTTATTTTAGTTGTAACAAAAATTTTGATGATCTTTTAAGAAGAATTTTTCTTGATGA
AGAACATCAATTATTCTACCCAAAGTCAATTAGTGACATAAAGAATAATTCAGTTAAAAAACTATTAACT
GGTTACTTAGAGAAATTTAATAATCTATATTTAGGTGAAACCTATGAAGAAAAATTAAATAACGTCCCCT
TATTTTACCATGACTATGTAGCTTTTGATCATTTTAATACACCTGAAATTCAAGGTGAATTTATTCGAGA
TATATTTAAGAAGTGTATCGTTGTTAATCATTATACTTACAGGCTGCATCAAACAATAATTATGAACAAA
AACATATATGAAGGGCAATCGGTTTTATCTGTACTTGTTGATGTTCATGAAAAATTGAAATTTCAGAAAA
ATGAAACACCCTTACCTAAAATTAGATTCAAACCCTCTATAAAAAAAAGTGCATTCCTTTACTTACAAAG
TGAGAAAGATGGATCCCTGGTTTTAAATAACGTTAATATTGGAAGTGGTACAGTATATCATCGTTATGGT
GATTTATTTAATGAAAATATTAAAAATAAATTAAAAACATACTATGAGAATCTATTTACGTCTCCATATC
CTATTTATGAATTAGTTATTGATGAAGAAATCTCAAATCATATTGATGTAGGTAAATCAATTTTCCCAAA
ATTAGTATGGCCAAAAGACCTTTTAAAAGTAAAAATGCATATCTCAAACGATGATATTACATTTTCGCTA
GGTGGTAAACCTATTCAATTAATATATGTTGGGACAGTTCCCTTCCATTTATTCTCAGGTATAAAAGGGG
ATTTTTTGAATTTAATTCATCCTTGGACGGTGGATATTAATAGGCTAAACAACTTGGATACAAGAAAAGT
CTCTCAACTGAATTGGCAAACTATTAGTGATTCAGATGATTTATCTGATACTCAATTTTACTACACGATC
ACCGACTATTTTAAAACTAATAATTTACCATTCGAATTTTTTGTAAAGAAAAAAATGATTAATTTTACTT
CTAGAAAACCCATATGGATTTCATTATATTCAGTCGAGTCTATAAAAGTTCTAAAGCATTTATTGTTGAA
TGAACGCTATATTGAAATAGAAGAAGTAAAGCCTAGGCTCAATGGAGATTATGTAGAGGAATTTTGTATA
TTAACAACGGAGGGGGAATGTTAA
 Primer design

Protein Sequence:707 a.a.
>BFZC1_19165|ThioFinder1313 Lysinibacillus fusiformis ZC1
MKDTICMKRKTLFKTERLDDLKDEPLKMYSNWNNYKENLEKIKKQLLKMLNEKTEILYINKNLKEMKSYL
NIKKTLKKERIIREAILDEIDDKQIKEHSRIYNETFELIKSIEKQVEDAFLRKVNRYESFLTHSEFQQAL
SITAFEAYEQLFNPEITKDSVNRARYRFIQRATVKTSPLSYLGKTIYLSDETKITEQIKLNNVVKSLILM
ASLHNKSLDHLLQIKVSPKFKKCNGMDAVYFEKNYLLKGVDWILKQDDILHQKEVVDFLSKIQHCETPAE
VKREVSNCEEITYEMLINNGLVIPNFNFYFSCNKNFDDLLRRIFLDEEHQLFYPKSISDIKNNSVKKLLT
GYLEKFNNLYLGETYEEKLNNVPLFYHDYVAFDHFNTPEIQGEFIRDIFKKCIVVNHYTYRLHQTIIMNK
NIYEGQSVLSVLVDVHEKLKFQKNETPLPKIRFKPSIKKSAFLYLQSEKDGSLVLNNVNIGSGTVYHRYG
DLFNENIKNKLKTYYENLFTSPYPIYELVIDEEISNHIDVGKSIFPKLVWPKDLLKVKMHISNDDITFSL
GGKPIQLIYVGTVPFHLFSGIKGDFLNLIHPWTVDINRLNNLDTRKVSQLNWQTISDSDDLSDTQFYYTI
TDYFKTNNLPFEFFVKKKMINFTSRKPIWISLYSVESIKVLKHLLLNERYIEIEEVKPRLNGDYVEEFCI
LTTEGEC