Home 

Gene Symbol:  
BFZC1_19185
Organism:  
Lysinibacillus fusiformis ZC1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
95450..96964 [1], 1515 bp
Product Function:  
putative cytoplasmic protein
Product Locus:  
 EFI66954.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1515 bp
>BFZC1_19185|ThioFinder1317 Lysinibacillus fusiformis ZC1
ATGTCTCAACTAATAAGTGATCCCATGGTTCATTTCCCAAAGGAACCACAATTATTACCGAATATTAATA
TTATTATAGAGGAAGCTGTAACCGTTATTGGAAGTGTGGATGGTCCATTTCGATTAAATGGAACTAGAGC
AAAGGAAATTGTCAGTGATTTACTTCCTTTATTAAAGGAAGGAATATCTTTAGAAGCATTGTATATAAAA
GCTCGTTATTCAAAAGAAGAAGTTGATCAGTTGCTGGAAATTTTATTTATAAAGGGTTGCTTAATGCAGA
AGGAAGACCATCAATTATTAAATAGAACAGATAAATTCTATTTAAGATATATATCAAAATTCAAAAATTT
TAGTAGTCTGAAAGCTTTTAAGACCCACCTAGATAATTGCTGTATTTATATTCTTGGAAAGGATGCCTTA
TTAGTAGAAGCTTTAAAAGAAAATTTCGAATCATTTAATATTATGACTCTTACTGCTAATGACTTTAACC
CTGTGTCACTTTCAAATAAGCGATCTTTATGTATTTATACTGATGATTTTAATGAAACTTCTATTAAAAA
CATTTTAGGATATATGGATGTATTATATGTAAATTATAAAGGACAACAATTTGGTCCGTTATTTTCTCAA
AAAGGGATTATGCCGGATGAATATATCGGAATTTTAGAATCTTTAAAGATTAATCCAAGTGTTGAAGAAA
TGGATGAGAAAGAATTTTTAAATTGTGTAACATTAAATACTGTACGCGAAATCGGAAAAATAAATAATAC
ATCACTAGTTGAAGGGTTTTATAAAAAAGAGTTTATTAACTTCAAATATTATGCACTAAGAAATAAATTG
TATGAACACGATGTCCCTAGTATTGTATCATTTGAAAAATTTATACAGTTTCCTGCGAGTAAATTTGTTA
ATGCTTCTTCACATTTAACTCATTATAAATCTAAAAATTTGAAACTAACTGTATATAATCAAGCGTCTTT
TTTGTGGAAAAAATTAGATGATGTAGAGATCCCTTCTCAAATCGATTTACTGATGCGAAAAACAGTCGGT
TACAAAGATTTAGAAATCAAATATAAACGTTATACTCCAACAGGAGGTAATATTAATTCGAATTTGTTGT
TTTATGTAAATATTAACGAAAAGGCATTCATGGGTAAGGGTATTTACTTCTATAACAATACCGATAATAC
CTATTATCAAATAATGAATGATGAACTTTTAGATGTTACAAACTTCGTAAAACTTTTGGATAGAAATTGT
ACTACCAATCAGAATGTTCAAGGATATTTGCTCTTAGGGAATGATACAGACATTATTGCGGAAAAGTATA
ACGATTTTAGCTTTAAGATTGCAAATTTAAATAATGGTATTTTATTGTCTAACCTAATGTCCTTATCAAA
AATTGTCGACGTTCAATTAAAAGTTCACACTCGTTTTGATGAAAAAGCAATACTCCATCTTTTAGGAATT
GAACGTTCAAATGAAATAATTAATTTTGTTGTGGAGGTGGTTTAA
 Primer design

Protein Sequence:504 a.a.
>BFZC1_19185|ThioFinder1317 Lysinibacillus fusiformis ZC1
MSQLISDPMVHFPKEPQLLPNINIIIEEAVTVIGSVDGPFRLNGTRAKEIVSDLLPLLKEGISLEALYIK
ARYSKEEVDQLLEILFIKGCLMQKEDHQLLNRTDKFYLRYISKFKNFSSLKAFKTHLDNCCIYILGKDAL
LVEALKENFESFNIMTLTANDFNPVSLSNKRSLCIYTDDFNETSIKNILGYMDVLYVNYKGQQFGPLFSQ
KGIMPDEYIGILESLKINPSVEEMDEKEFLNCVTLNTVREIGKINNTSLVEGFYKKEFINFKYYALRNKL
YEHDVPSIVSFEKFIQFPASKFVNASSHLTHYKSKNLKLTVYNQASFLWKKLDDVEIPSQIDLLMRKTVG
YKDLEIKYKRYTPTGGNINSNLLFYVNINEKAFMGKGIYFYNNTDNTYYQIMNDELLDVTNFVKLLDRNC
TTNQNVQGYLLLGNDTDIIAEKYNDFSFKIANLNNGILLSNLMSLSKIVDVQLKVHTRFDEKAILHLLGI
ERSNEIINFVVEVV