Home 

Gene Symbol:  
BFZC1_19175
Organism:  
Lysinibacillus fusiformis ZC1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
93590..94855 [1], 1266 bp
Product Function:  
putative cytoplasmic protein
Product Locus:  
 EFI66952.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1266 bp
>BFZC1_19175|ThioFinder1315 Lysinibacillus fusiformis ZC1
ATGAATCACAACTTTGATAAGTTCATTATTTCTAAACGTAATGTAGTGCCCCCTCGTGGTGTACAAAAAA
CGAATATTGGCATTGCATATATTGCTGATATAAACCATTATCGAACTGTAAATGCAGGAAAGAAAGTGCA
TGACTCGGTAGCAAATCTTTCTGGTGCAGGGACAGGAGATACTCCTGAACAAGCTATGTTTTTAGCAACA
ATGGAAGCATACGAACGTTTAGCAAACAGTATTCCTACAAAGCGAACAATAGTAGCAACTGAAGGAAATT
TAAAAAACTTAGCTGTACCACTTACTGATTTTCCTCAGATTAGTGAAAGAGAAACAAACAGCCATTTAAA
ACCATCAAATAGTAATCAAAAACTTAGATGGTGTGAATCGCTTAATATTACAGAAGATAAGATTTGTTAC
ATTCCTCAAATATATATTAATTTATTTACACAGTTTGATTATGAAGGGGAAAATATTTCGCATTCAATAT
CTACTGGTTGTGCTATTCACCAAAATTATATTGATGCCGTAATTAATGGGATTTATGAAGTAATAGAAAG
GGATGGGATAGCACTTACTTGGCTATTAAAGCGTCCATTAAAAGAAGTAAGTGAAGAAAGTTACCTAGAG
GATCTAAATATATTTACTCATCCTTTTTTAGGAAAAACAACACTATATGAAGCATCAACCGTTGATGGTA
TACATACGTTTTGTCTTCGAGCTGAAACAAATCACTCTCAAGAGTTAAAAAATGTACTTATGTTTTCGAC
AAATGCATGCCCGAAAAAAGCCATACACAAAATAAAAAAAGAACTTATTTCTGTAATGTTTAGCCTTGTA
AGTAGAATTCCAAAGCAAAAAGAACTTCTAAGTCGTCCATATGATTTATTTTACTCAGTAGATGAGGGAG
CATTATTTATGGCGCATGAAACGATGGCCAATAAGTTCTCGTTTTTAGAAGGAAATGGGATAGTCCCATT
CCCAACTGAAAAACCAATTTTTAATTCTAATCTAGAAGAACTTCATTATTTAATTGATTGTTTAAAAGAA
CAGGGACATAAGGTTTATGTGACAGATTTAACATCACGTGAATGCAGAGAACAGGGTTTATGTGCAGTGA
AAGTGACAATACCATCATTACAACCTATTTCATTTGTTCATTCAGCACGATATTTAAAAAGTCAACGTTT
AGAGTCATTTGCCACTCAAATGTTTGGATATTATGATGAAGAACTTATTAATGAGGAACCTTTACCATTT
TCATAA
 Primer design

Protein Sequence:421 a.a.
>BFZC1_19175|ThioFinder1315 Lysinibacillus fusiformis ZC1
MNHNFDKFIISKRNVVPPRGVQKTNIGIAYIADINHYRTVNAGKKVHDSVANLSGAGTGDTPEQAMFLAT
MEAYERLANSIPTKRTIVATEGNLKNLAVPLTDFPQISERETNSHLKPSNSNQKLRWCESLNITEDKICY
IPQIYINLFTQFDYEGENISHSISTGCAIHQNYIDAVINGIYEVIERDGIALTWLLKRPLKEVSEESYLE
DLNIFTHPFLGKTTLYEASTVDGIHTFCLRAETNHSQELKNVLMFSTNACPKKAIHKIKKELISVMFSLV
SRIPKQKELLSRPYDLFYSVDEGALFMAHETMANKFSFLEGNGIVPFPTEKPIFNSNLEELHYLIDCLKE
QGHKVYVTDLTSRECREQGLCAVKVTIPSLQPISFVHSARYLKSQRLESFATQMFGYYDEELINEEPLPF
S