Home 

Gene Symbol:  
HMPREF9948_1490
Organism:  
Propionibacterium sp. 434-HC2
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1002..3614 [1], 2613 bp
Product Function:  
lantibiotic dehydratase, C-terminal domain protein
Product Locus:  
 ZP_08546060.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2613 bp
>HMPREF9948_1490|ThioFinder1339 Propionibacterium sp. 434-HC2
GTGCATCTCAGTCCATATGTAGTCTTTCGCAGGACACGACTCGCCTACTCTCAACTTCAGAGCAGCTCCT
TCGACGCACTCTGGCAGCAAGTGCAAGAAATGGTCGATAAGCATGCGCAATTAGAGGTTCAGACCAGCAG
GCTTACGGCACACCTGGAGTCTGTTATTTCAGTAACTGCGCCTCGTGACAGATCTCGACTAATCACATTA
AAACGTGACGTGCATAACATGCGCGTGGAAAAAGTGAAGCAAAGACTACTGCACTGTCAGGGCTGCACGG
CTAGCAACATTATGGAGCCTGTATCTAGTTGGATCGATACATGTCGATCATACGAAATACTTGAGCGTCG
GTTGAGTCAAGTATATGCGGACAGCCGAGACGAAGTGTCTCGTCACTACAGGTCCCTCTACCAGGCTGAC
GCAATAGAGCCAAGCATTCAACTCTCAGGTGGCCAGCTCCACAGTGACCTGACGCGTCTGATTAGCCACG
GTTCTAGGATAAAACCCACTAAAGAGCGGACTCTGGAAACGACTCTTGTAAACTATCTCTACAGGGCAGC
AACAAAGCCATCACCTTTCGGTCGTTTCGTGGAAGTAGGGGCCTTCGACCCGTCTCAACCAAATTCCGAA
CCTCGACGCTGCAGTGAATCCAGCGTGACGACAAACCGGATTCTTACCAGCTGGCTCACTGCAGTAACAG
CGCGTTCTTTCGCCGCACCAGAAATGCTTGCTATCCTCAACAGCACCCTGCGCGTTAAACGCGATATAAT
CCAGTTCATTGGAATTCCACCTGGGGAGTGGCGAGGTGCACCGAGCATTCCCGAGGAGCGCCTGCTAACT
ATCCGCAAGCGCGAAGATATGATGTCTGTTCTTAAGCTCCTAATGGGCGGCCCAAGATCAGTCGGTGACC
TCATTATTGCCCTTAATGACCAAGGCATAGATGAATCACACGCAACTAATCTTCTCAGCAGTTTGAGTAC
AGCAGGGATAATCTTCTTTCGGCTCCCAGTAGATGACCATGACGTACACTATGTACAGACTGCGTGTACA
GCGCTAAGGTTAACCAAAGATGAGTCACTTCGTGCCGCTTTCCAAAGTCTGGCGAACGCTGAAAAGGAGT
TCCCCACAGCGTCAGTCGCCACGCGTCACGACCTTCTCCTCAGCATCAAGGATTCCGTGAATACTGTCGC
GTCGGCACATGATGTGCCGGCCCCACCGGACAGCGTACTCAAGAGCCCTTTGTATGAGGACCTCCCCGCC
ACCGCGGCACCCCAGACATGGGATTCGAACACGGTTGAGAGATCAGCCCGCGCACTCAGGAGCATCTGGC
TACTGAGCGATTTAATGGATAGCTCTCAACGCCGACAGTTGGGCCTCTCCCAGTTCATAGCAGACATGAA
TAATGGCGCGCCAGTTACTTTTCTGGATTTCTTCGACTCGTTTTCGCGCCTTAGCATTCGTGAGCGCCAA
GGAATCCTGCGCGGAGAAAACTCACCGCAAATCGCCCGTTTCGCTCAGCAATATAGTGAAGCATTGCTTA
AAATTCGCGATGCCGTTAACTACACGCAGGACGAAGCCCACCTTGAATCTCAGGTAATTCTCGATGCGAT
CACCAATATTGATGATTTCCGACCGACTAAGTCGGTCACAATTCGAGGACAATTCACAACATCGCTCACC
TCCCATATAAGCCAACTGATAATCAACGGTGTTATGACGGGATACGGTACATACATGTCCCGATTCGCAA
CATTTGTAAACCCATCAGGTACTTGGAGTCTAGTCGACGGGATTCGGAGACATCTATCCGATCATTTTCC
AGGTCAATGTGATTTGAATTCCGTACTGGGATTCAACTTCAATGTTCATCCGCAAATGACAGCACATAGT
ATCGCCTATCCTGGAGTAGTTCCTGTGCTTAATGGTGCCAAGACACATTCGATTCAGGATTTAATACTGA
TTCCAACTGCTGAAGCAGGTCCGCGCCGCGTCGCTATCTTTGATAGAGCAGAGAACGAACTTATCGACCT
CCAGCCCATGAATTTCATGGTTCCTTTTGGGGTGCCTTTGCTGTATCGGACTCTAGAGTTCCTGTGCCCA
TCGACCAGATACCTATGGAACCCAGCTCAAGACCTTCTGGATATCCCAATGATAGAGAACAGTTGCCCTC
GGATTTACTTTGACGACGTAGTGGCTCAACGCCGTTCCTGGACGTGCAGCGCCGAGACGCTCCCGTGTCC
CCCAGAGAAACTCTTTAGGGGTGATCTTGCTGCTTTGCAAGCCTTCGACTCGTGGAGACTATCAGCGAGG
GTACCCAGACATGTCTTTGCCCTAGTACAAACGGCTACGGAAAGACAAATTTTTTCCGGAGCGGCCGACG
CGCCAACCTTGCTCTCCGAATACAAGCATCTTCGGAGAGCAAGTGTGCATAAGCCAATCTACCTGGATCT
ACGAAACCCACTTCTAGTCCGTTCTCTCGCGAAGGTGATCATGTCCAGGCCCGAACTATATGTCACGTTT
TCCGAGTTCCTCCCATCGGAGGCCGATTACACGCAGAACGGAAGCTGCCCCAGTTACGCAGAGGAGTACT
TCATTGAACTGTGTGCCGAGTGA
 Primer design

Protein Sequence:870 a.a.
>HMPREF9948_1490|ThioFinder1339 Propionibacterium sp. 434-HC2
MHLSPYVVFRRTRLAYSQLQSSSFDALWQQVQEMVDKHAQLEVQTSRLTAHLESVISVTAPRDRSRLITL
KRDVHNMRVEKVKQRLLHCQGCTASNIMEPVSSWIDTCRSYEILERRLSQVYADSRDEVSRHYRSLYQAD
AIEPSIQLSGGQLHSDLTRLISHGSRIKPTKERTLETTLVNYLYRAATKPSPFGRFVEVGAFDPSQPNSE
PRRCSESSVTTNRILTSWLTAVTARSFAAPEMLAILNSTLRVKRDIIQFIGIPPGEWRGAPSIPEERLLT
IRKREDMMSVLKLLMGGPRSVGDLIIALNDQGIDESHATNLLSSLSTAGIIFFRLPVDDHDVHYVQTACT
ALRLTKDESLRAAFQSLANAEKEFPTASVATRHDLLLSIKDSVNTVASAHDVPAPPDSVLKSPLYEDLPA
TAAPQTWDSNTVERSARALRSIWLLSDLMDSSQRRQLGLSQFIADMNNGAPVTFLDFFDSFSRLSIRERQ
GILRGENSPQIARFAQQYSEALLKIRDAVNYTQDEAHLESQVILDAITNIDDFRPTKSVTIRGQFTTSLT
SHISQLIINGVMTGYGTYMSRFATFVNPSGTWSLVDGIRRHLSDHFPGQCDLNSVLGFNFNVHPQMTAHS
IAYPGVVPVLNGAKTHSIQDLILIPTAEAGPRRVAIFDRAENELIDLQPMNFMVPFGVPLLYRTLEFLCP
STRYLWNPAQDLLDIPMIENSCPRIYFDDVVAQRRSWTCSAETLPCPPEKLFRGDLAALQAFDSWRLSAR
VPRHVFALVQTATERQIFSGAADAPTLLSEYKHLRRASVHKPIYLDLRNPLLVRSLAKVIMSRPELYVTF
SEFLPSEADYTQNGSCPSYAEEYFIELCAE