Home 

Gene Symbol:  
HMPREF9948_1494
Organism:  
Propionibacterium sp. 434-HC2
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
7564..9159 [1], 1596 bp
Product Function:  
bacteriocin biosynthesis cyclodehydratase domain protein
Product Locus:  
 ZP_08546061.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1596 bp
>HMPREF9948_1494|ThioFinder1343 Propionibacterium sp. 434-HC2
ATGAAGGGTATAATCAGTGGTGAACAGGTGGGAAATGCAGCTCGCTTTGACAAGCAGTTCAGGGTCCCTC
GTCGGCCGAGCAGGCGGCTCGGTGTCGATATTGAGATCCGTGAGGATGCAACAATTCTTTGGGGATCAGA
TCGTCTGCAGACATTTACAGGAGGAATGAAACCTTCACTGATTGAGGATATTTTACGAGCGTGCGACGGA
ACTAAGACGGCACGTGAGCTCGCCTCTGTATGTGATGTTACGGAGCCCTTGATGGACAAGATAGTGGCCC
TTCTCTGGGTCTCGGGTGCTATTGAGGAGGCGGGCCCGACCGATGTTGAAAGTTCTCCGCTTGGGGTCCT
TTTGTCTCGCCTTGGGAACGCAACTGGGGCGAATGCTAGCTGGCAGGAAGCTCAGCACAGAATTAACAGC
ATGCCGATCTGTGTTATGCCCCATTCGGAACTTGGAACGGAGGTTGCGGGCGCGCTTGCTGGCACCTTTG
AGGTTATCAATGAAGAGGCAGCTTTTGAACGCGGCGTGGTTCTATTCATCTTTATCGAAACCGCGTCGTC
TAAGATCGAACAGCATCACAAATTTGATGAACTGACAAAGAGAAGAGTGCTATTGGTTAGCGCTGCGGGT
GACGAAGTTGTAGTGGGGCCGCTTTATGACCAGGCTATAACGCCCTGCCTTCGGTGCTGTTCGTCATCGA
GGATCAAGCTGGATCGGGGTGCCTCGAGCCCGGCGCAGCTTCGTCTCATGGCTGGAATTGTCTCGCATCA
TATTGTTGCGTTGGTAAGCAGGGCGTTACTCTCACCGCTGCCCACGGATTCCTTGGCGCTGAATGTGGTC
ACTGGTGTCCAGCGCTACTCTCCCCCGGTGTCCAGACCGGGTTGCCCCGAATGTTCGCATGCGATCCCAG
CTATTGCTAGTGAGCCGACGGTCGGTGCCGTGTACGAGGCTTCCGTAGCACTCCCTCCGCGAGAATTCGT
GAATGTAAGGGACTATCAAGCCCACTTCTTGAGCGCAAATCAACAACTTCAAACGAAATTTAAGTCATGG
GGAAAAAGGGAAAAATTCCCTTTGCCTGACATTAATATTTCAGACCTACATATACAGATTGACGACCTTC
TTTTTTTAGCTGCTGCCCTTAGGTTTGGGTTCGGAATAGACCCGGAGCGGACCACTTCAAAAATAGCGAA
GCGCTGGACGGCCTCTGGTGGAAACATTGGCTCGGTAAACGCATTCGTGAGCCTTCCTGCGATGGTAGGG
CACATTCCCAGTGGGATTTATGGATATTCAGTTAGCGATCATTCCCTAGCCAAAGTTAGTCAGGAGTTGA
TTTCGGCGACTGACATCATGATCGCGGCTTCTGCCGACCTACGGAAGATCGCTTCTAAATATGGGACATT
CGGCTTGAGGATCGCGATTATGGACGCCGGGTGTGCCCTTTCAACGGTGCGTCGTGTCTGCCGGGAAGTA
GGCCGTACATTTTCGATGTGGAGCGCTGACCTCGACGCTGGGTCTATTAGCGAGATGCTGCATCTTTCAA
GTGCGCGTGAGCCTATTATTGGAGTTTCAGTGCTGGGAAAGGGGCAACGAGGGTGA
 Primer design

Protein Sequence:531 a.a.
>HMPREF9948_1494|ThioFinder1343 Propionibacterium sp. 434-HC2
MKGIISGEQVGNAARFDKQFRVPRRPSRRLGVDIEIREDATILWGSDRLQTFTGGMKPSLIEDILRACDG
TKTARELASVCDVTEPLMDKIVALLWVSGAIEEAGPTDVESSPLGVLLSRLGNATGANASWQEAQHRINS
MPICVMPHSELGTEVAGALAGTFEVINEEAAFERGVVLFIFIETASSKIEQHHKFDELTKRRVLLVSAAG
DEVVVGPLYDQAITPCLRCCSSSRIKLDRGASSPAQLRLMAGIVSHHIVALVSRALLSPLPTDSLALNVV
TGVQRYSPPVSRPGCPECSHAIPAIASEPTVGAVYEASVALPPREFVNVRDYQAHFLSANQQLQTKFKSW
GKREKFPLPDINISDLHIQIDDLLFLAAALRFGFGIDPERTTSKIAKRWTASGGNIGSVNAFVSLPAMVG
HIPSGIYGYSVSDHSLAKVSQELISATDIMIAASADLRKIASKYGTFGLRIAIMDAGCALSTVRRVCREV
GRTFSMWSADLDAGSISEMLHLSSAREPIIGVSVLGKGQRG