Home 

Gene Symbol:  
HMPREF9948_1492
Organism:  
Propionibacterium sp. 434-HC2
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4545..5627 [1], 1083 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_08546080.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1083 bp
>HMPREF9948_1492|ThioFinder1341 Propionibacterium sp. 434-HC2
ATGAATCCAAAAAACTCCAAAGTGACGGAACTTTGGTTTCCAGATAATTCAGACTCGCCATGTACTCTTC
TTCTCGACTTATCTCGGGCCTCCGCTGAGGGCACTGAGCCTAGTCCTCAATACTACTGTCGAACTTGGGA
CCCAACAACAAAAGATCCCGGAGTAAGGGTTGGCATACTTGATCCCAACCGCTTAACTCATCAAACGGCT
TTCCTTGGCGGTTCCGGTATTACGCATCACTTCTTGGTAATTGAAAAACCACCCAGCTGGCCTCTTCTAT
GGAACGCGGGTTTCGCGGGCTTGAAGCTTTCCACGATAAGCAAACAATTGTTCACCGCGTCATATCCATG
GATGGTAAAGTGGGCGCTACAGGCATCGGCTTGGACGGACGACGAACGCCTTCTGGCTCTTACGAAACTT
CTAGTTGCCCACGCTGATGCAAGCCTTCCACCGGTCGATAAGACTGAAATGCTCGGCCGCCTCCCTTTGA
AGTTGAGCTTGCGACTGATCACATATCGTTCCCACTACGAAAGCATCCGCGCTCGCACGATTGACCCGAA
AGCGATGGATACTGCGGTTAATCGGGCCTTCATGAAGTATCAAGACGAGCTCCTGCGATGGTCCCAGTCG
TTGACATGCTCGTCGAGCTATCGTGAGAAAGAATGGAGTAATCCCAACCTTTCAGAATGGAGCGCCATCA
TTTATTGCCATCTCCCACAAATTAGGCAACTCCTCAGCGGGGGAGGATTAACTGTCGCGGGCCCGACACG
CGAGGATATAGAAGCCTCCTTAGGTCACAGTATTCCTGATACACGATTTCACGAGCGTCTTGACCCCGCC
ATGCAGTATTATCTCAATCATGACCAAGACTTCACGGCATACAGATTCTGCACGGGTTTTTTGTACAGCA
ACCTGTACTCGCTAGGAATACCGTTGAGGCTGCGCTACCTTGTCTGTGGGTTGGCAGCACGTTTCAACGA
GGAGCTGTCGGACACGACTTGGCGCGATTTACGGGATCTCTTCCACGAGGCTGCTACTGTTGCATATTAC
ACACGCGACACAGACGGGAGCGGGATTAGATAA
 Primer design

Protein Sequence:360 a.a.
>HMPREF9948_1492|ThioFinder1341 Propionibacterium sp. 434-HC2
MNPKNSKVTELWFPDNSDSPCTLLLDLSRASAEGTEPSPQYYCRTWDPTTKDPGVRVGILDPNRLTHQTA
FLGGSGITHHFLVIEKPPSWPLLWNAGFAGLKLSTISKQLFTASYPWMVKWALQASAWTDDERLLALTKL
LVAHADASLPPVDKTEMLGRLPLKLSLRLITYRSHYESIRARTIDPKAMDTAVNRAFMKYQDELLRWSQS
LTCSSSYREKEWSNPNLSEWSAIIYCHLPQIRQLLSGGGLTVAGPTREDIEASLGHSIPDTRFHERLDPA
MQYYLNHDQDFTAYRFCTGFLYSNLYSLGIPLRLRYLVCGLAARFNEELSDTTWRDLRDLFHEAATVAYY
TRDTDGSGIR