Home 

Gene Symbol:  
getE
Organism:  
Streptomyces sp. ATCC 55365
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
12248..13204 [1], 957 bp
Product Function:  
lantibiotic-type dehydratase
Product Locus:  
 AEM00618.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:957 bp
>getE|ThioFinder1391 Streptomyces sp. ATCC 55365
ATGCCTGCCCGACCCCCTGGCCGGGACGGGCCATGTGACCGAGTACGCGGTCGAGGTGGGAGTGCGACGG
TGACGACCTGGGCGTCTTGGCATGTGCACCAGCACCACGATCAGGATCGGCTGCTGGTCGAGGCGGTGGC
TCCGCTGATCCGGGCGGTCCGTGCCGACGGGCTCGCCGACCGGGCGTTCGTCCTGCGGTACTGGGACGGC
GGCCCGCACGTGCGGTTGAGGCTGCGCGCGCCGTCCGACGCGGCCCTGGCCCAACTGGAGGCACGGGTAC
CGGCCGAACTGCTGGACTGGTGCCGGCAGCATCCGTCCGAGCGGACCATGGGCGCCGAGGAGTACGCGCT
GCTGCGCAACCGGATCGGCGACCCTGCCTCGGCCGCCGAACTGATCCCCGACGGCTCCGTCGTACGGGCC
GCCTACGTCCCGGAGCACCAGCGGTACGGCAGGGGAGCGGCGTTGGCGGCATGCGAGGAGCACTTCGACC
ACAGCACGCGGATCGCTCTGGACGTGCTCGCCGCAGGCCCCGCGGACTCCGCCCGGGACTCGCTGGTTGT
GCTCGTCCTGGCCCGCTTCCTCATGGCACGCGGCAGCCGGGTCGGCCTCGGCTGGGCCCGCCGCGTCCAG
GAGTTGGGCGTCCCGGCCGCAGCACGGCTGGACCTGACCCGGATCACGGCCCTGCTGGAGCGGCCCCCGT
CGCCGGTCGAGCGCATCACCCGCTCCCTCGAACGGCTCGAGGCCGGGCTGCGCATGGCAGGGGACGACTA
CCGCCCGCCGACCGTCGGGTTCGGCGGTGTGACGTTCGAGGCGACCGAGGCACAGGACCCGATCACGACG
CTGGACATCTGCATTCATCTCTTCGCGAACCGGATAGGAGTCACCATGCCCACAGAGCTGACGCTGCGCG
CCTGTCTCGCGCAGGCACTGGTCGCCGCGACCAAGGCGGACGCGTGA
 Primer design

Protein Sequence:318 a.a.
>GetE|ThioFinder1391 Streptomyces sp. ATCC 55365
MPARPPGRDGPCDRVRGRGGSATVTTWASWHVHQHHDQDRLLVEAVAPLIRAVRADGLADRAFVLRYWDG
GPHVRLRLRAPSDAALAQLEARVPAELLDWCRQHPSERTMGAEEYALLRNRIGDPASAAELIPDGSVVRA
AYVPEHQRYGRGAALAACEEHFDHSTRIALDVLAAGPADSARDSLVVLVLARFLMARGSRVGLGWARRVQ
ELGVPAAARLDLTRITALLERPPSPVERITRSLERLEAGLRMAGDDYRPPTVGFGGVTFEATEAQDPITT
LDICIHLFANRIGVTMPTELTLRACLAQALVAATKADA