Home 

Gene Symbol:  
getD
Organism:  
Streptomyces sp. ATCC 55365
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
10176..12320 [1], 2145 bp
Product Function:  
lantibiotic-type dehydratase
Product Locus:  
 AEM00617.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2145 bp
>getD|ThioFinder1390 Streptomyces sp. ATCC 55365
ATGCGCGACGACGCCGCGGCCGCATTCCACACCTGGTCGGGTGCGCGGGACCGGTTACGCGACCTGGACG
CGCAGTTGGGCGACGCCCTCGCGGCAGCCGAACGCGACGACGTGGAGCACCTGCGCGGACTGTGTCTCGA
CCCACGGTTCCTCACCGGACTGCGGGCGACGAGCCGAGACCTGGCTGACACCGCCCGCCGCTGGGCCACC
GGGCAGACCGGCGCCCCGCAGCGCAAGCGACTCCTCCGGCTCACTCGCATGGCGGCCCGCGCCGGCGCGA
AGACCAGCCCGTTCAGTTCCTGGATGGTCACGGTCCCGGCCCGCTGGGGTCGCCCCGGCGGCGCGGTCAC
CGGAGAGCGGCTGCTCGCCGAACTCGACGGTGCGGTGGTCGGCGTACTCACCCGGGCCCTGCAGGCCACC
CTGCCGGACGCCGCAGACCTGGAGGTGCGGGTCAATCCGAGCCTTGTCCCGGTCGAGGGCGGCTGGCTGT
TCATCCGGGCCGGACAGCGGGAACAGGCAGTCCGGGCGGCTGCGCACCCGGCGATCGACGAGTTACTGCG
TGCCCTGGCACCCGGGGACACCGAAGCGAGCCTCGCCGCTCGGGTGCCCGGAGGGACCGGCCTGGTGAGC
AAGTGCCTGACCGCCGGACTGATCGAACACTGTCTTCCCGTCGCGGACCATCACCCGCGCCCGTGGGCCG
CATGGGCCGCGATCGCCGCCGAGCGAGGCGTGACGGAGCTGTCCGCCGGGCTCTCCGCGCTCGACACGGC
GCTGCACGCCGCGGAAGCGCCCGTGGCGCAGGCCGCTGCCGGGCAGGTGGCGCACCACCTCGGGGTCGAG
CTGCCGCCGGTCGAGGTGCATGAGATGTCGGTCGCGACCGGCTGGCCGTACGACCTGCCCGCCCGCCCCG
ACGGCACGGCGCTCGCCGAACTCGACTGCGCCCGGCGGCTGCTGGCGCTGACGGACGTGAAGTTCCCCGC
GAAACTCGCGGCTGCCGAGCACCTGGCGAAGCGTTTCGGCGCGGACTACGACGTACCACTGACCGTGGCC
CTTGACAGCCTCGCCCGGGCGCGCCTGGACGCCGACGACGATGTCTGCCGGATCATCGGGCCGGCGGCAC
CGCCGTGGGGAGCCGACCTGGCACGCTGCTCCGGCGGCCTGGTACGGGAGTTGGGCGCGGCGCTGCCCCG
GCTCACTGAGGACGTGCTGACCCTGGCCGCGAAGGGCCCGCTCGCCGTGGCCGATGTACGACGGCTGCTC
GACGACTTCCCTTTCACCCACCCGAACCGTTCGGCCACGTTCTACCTGCAGGAGACCTCCGAGGCCGCGA
TCCGCAGGGTGGTGAATGTCGTACACGGCGGGCACGGCCGTGGCCGGGGTCGTCTCGCCGCCCGGGCGGG
CATCCCCGTCACGGACCTGGTCACCACCGTCGACGAGGACATCGTCGAGATCGGCGGACTGCTGGGGTCG
GCACTGAACTCGAGGGCGGCCACGGCGCCACGGGAGTTGCAGTATCCCGGTGCCACGACCGACCGGCCGC
GCGAGCAGCGCCTGCCGATGGCGTCGGTGCGTGTCGTGCCCGGTGCGCACGGCCTGCCCGCACTCCGGGA
CGAGGACGGCCGGGACGTGTGCCTGGTGCACCTGGGCATGGCCGCGGACCTGGCACTGCCCGCGTTCGTC
AGGCTGCTGGAGCAGGTCTTCGGAAGCGCCTGTCTGATCCACCCGAGCATCGCGGTGTTCACCCCCGGAG
CACCCGGGCGCACCGGGGCGCCGCAGTCGGCCACCCCACGCGTGACGCTCGGAGCCACCGTGCTGCAGCG
GGCGCGGTGGCTGCTGCGACGGGAGGAGTTCCCCGGCGGGGGCGAGCCGCGCGGATCGCTGCGTGCCTGG
CACCAGTGGCTCACGGCGCACGGTCTGGGCAGCCGCTTCTACCTCCGGGCGTGGAGCTCCGCCGACCACG
GCCGGGGCCAGAGCAAGGCGCGCAAGCCGGTGTTCATCGACGTCACCAGCCCGCTGCTGTTCGCCGACGC
CGAGAAGATGCTTCGGCAGGCCGAGTTCGCCATCGTCGAGGAATGCCTGCCCGACCCCCTGGCCGGGACG
GGCCATGTGACCGAGTACGCGGTCGAGGTGGGAGTGCGACGGTGA
 Primer design

Protein Sequence:714 a.a.
>GetD|ThioFinder1390 Streptomyces sp. ATCC 55365
MRDDAAAAFHTWSGARDRLRDLDAQLGDALAAAERDDVEHLRGLCLDPRFLTGLRATSRDLADTARRWAT
GQTGAPQRKRLLRLTRMAARAGAKTSPFSSWMVTVPARWGRPGGAVTGERLLAELDGAVVGVLTRALQAT
LPDAADLEVRVNPSLVPVEGGWLFIRAGQREQAVRAAAHPAIDELLRALAPGDTEASLAARVPGGTGLVS
KCLTAGLIEHCLPVADHHPRPWAAWAAIAAERGVTELSAGLSALDTALHAAEAPVAQAAAGQVAHHLGVE
LPPVEVHEMSVATGWPYDLPARPDGTALAELDCARRLLALTDVKFPAKLAAAEHLAKRFGADYDVPLTVA
LDSLARARLDADDDVCRIIGPAAPPWGADLARCSGGLVRELGAALPRLTEDVLTLAAKGPLAVADVRRLL
DDFPFTHPNRSATFYLQETSEAAIRRVVNVVHGGHGRGRGRLAARAGIPVTDLVTTVDEDIVEIGGLLGS
ALNSRAATAPRELQYPGATTDRPREQRLPMASVRVVPGAHGLPALRDEDGRDVCLVHLGMAADLALPAFV
RLLEQVFGSACLIHPSIAVFTPGAPGRTGAPQSATPRVTLGATVLQRARWLLRREEFPGGGEPRGSLRAW
HQWLTAHGLGSRFYLRAWSSADHGRGQSKARKPVFIDVTSPLLFADAEKMLRQAEFAIVEECLPDPLAGT
GHVTEYAVEVGVRR