Home 

Gene Symbol:  
getG
Organism:  
Streptomyces sp. ATCC 55365
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
14370..15644 [1], 1275 bp
Product Function:  
dehydrogenase
Product Locus:  
 AEM00620.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1275 bp
>getG|ThioFinder1393 Streptomyces sp. ATCC 55365
ATGGCCTGGCCGCACCATCTCAGCCTGCCCACCGGCCGCCGGACGGCCGAGGTCATCGCCCGGCTGGCCG
ACGGCGGGCAGCCGGCCGGCGCGGACGACGACGTCACCGAGGCGCTGCGGCGCGAAGGCTGGCTCTACGA
GGAGTTCAGCGACGATCGTGGTGTCGCGTTCGCGGTGCGTCCGCTGCGCGCCCGCGGACCGGTACCCGCT
GCCGAGGGGCGGCTCGACCTTTCCCGATTCGCGGTCATCCGGGTCGAGGCCGGCGCGCTGATGATGGAAT
CACCCCTGGCCAGTGCCGAGATCACGATCCATCGGCGGGAGCTGCTGACCGCCGCCCTCGACCCCGCGGC
CGACTCGGCGACCGCGACCGGCGGGCTTGCGGCCGCGCTGCGCGAGCAACTGCTCGGCACCGGTTTCCTG
GCCGACCCGCACGGCGACGAGACACAGGAGCTGCGCTACCGCCAGTGGTCACCCCACGAATTGATGTTCC
ACGACCGCAGCCGACTCGGCTACCGCGGATACGTCGGCGACGGGTTCGGCGGTACGTGGTGGGGTCGCGC
GGCGGGTTTCGAGCCCGAGCCCGCCGCCCCGCCTCCCTACCGTGGGCCGCGAGTCCCCCTCGCCGTACCG
GACTTCACGGATCGCCGTACGAGCGAGGGCTCCTATTTCGAGGTCACCGAGCGGCGCCGGTCCGAGCGGG
TGCATGACGACGAGTCCCCGATCTCGGTGGACCAACTCGGCGAACTGCTGTACCGCACCGCCCGGGTGCG
CCGCGTGCACGAGGAGGACGGCGTGGAGTTCGTCAGCTCTCCGCGCCCTTCCGGCGGATCGGTGTACGAG
CTCGAGCTGTACCCCTTGGTCACCCGGTGCTCGGGCCTGGACAGCGGCATGTACCACTACGACGCGCACC
GGCACGAGCTGGAGCTGGTGCGGCCGGTGAGCGACTACTCGGTGCGCCGGATGCTGCGGGTCGCCTCCCA
GGGCTCGACCACCGGCGCCGTCCCGCAGGTGCTGCTGGTCGTGGCGGCCCGGGTCGGCCGGGTGATGTGG
AAGTACGAGGGGATGGGCTATGCGGTGGTGCTGAAGAACACGGGGGTCCTCTACCACGCCCTCGCCGGCA
CGTGCGGCGCCATGGGACTGGCCGGCTGCCCCCTGGGCACGGACGACGCGGTCGCCTTCACCGAGGCCAC
CGGCCGCGATCCGCTGGTCGAGTGCAGCGTGGGCCAGTTCATCGTGGGATCCGTCCCGCGGCGGCGCGGG
GAGCAGAGCCGATGA
 Primer design

Protein Sequence:424 a.a.
>GetG|ThioFinder1393 Streptomyces sp. ATCC 55365
MAWPHHLSLPTGRRTAEVIARLADGGQPAGADDDVTEALRREGWLYEEFSDDRGVAFAVRPLRARGPVPA
AEGRLDLSRFAVIRVEAGALMMESPLASAEITIHRRELLTAALDPAADSATATGGLAAALREQLLGTGFL
ADPHGDETQELRYRQWSPHELMFHDRSRLGYRGYVGDGFGGTWWGRAAGFEPEPAAPPPYRGPRVPLAVP
DFTDRRTSEGSYFEVTERRRSERVHDDESPISVDQLGELLYRTARVRRVHEEDGVEFVSSPRPSGGSVYE
LELYPLVTRCSGLDSGMYHYDAHRHELELVRPVSDYSVRRMLRVASQGSTTGAVPQVLLVVAARVGRVMW
KYEGMGYAVVLKNTGVLYHALAGTCGAMGLAGCPLGTDDAVAFTEATGRDPLVECSVGQFIVGSVPRRRG
EQSR