Home 

Gene Symbol:  
getI
Organism:  
Streptomyces sp. ATCC 55365
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
17284..19218 [1], 1935 bp
Product Function:  
cyclodehydratase
Product Locus:  
 AEM00626.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1935 bp
>getI|ThioFinder1395 Streptomyces sp. ATCC 55365
ATGACGGGGACGCTGACGAACACCGACCGTGAACAGGCCGTGCAGTCCGGGCTGTTGGCGAGCAGCCTGT
CCGGCGCACCGGCGCTCCTGGGCGTCGAGGTGCGGGCGAGCGACAGCTGGAGCCTCCCGGCGGACGGGCC
GGTCGACCGCCCCTGGCTGAGCGTCCATACGGAGGTCGGTCAGGTGATCGTCGGGCCGCTGACCCGGCCG
GGCGTGGCGGGCTGCCCACACTGCCTCGACCTCCGGCGGCAGCGTGTCGACGCGAGCAGGCCCTGGCTTG
CCCGGCTGCGTGAGGAGCACGGAGCCCGACTGGAGCGCGACGTGCCGCAGTTGCTCGACCAACTCGCCGC
CGGGGTGGTGGCGGACGCGGCCGCTGCACTGGTGGCGGACGAGACGGCCGCCGGCCGGCCGGCAGGACAG
CCCGAGGTGCGGGAGCCGGTCGGCCAGGACGAGCCGCGACTGGTGGCGGTGATCGATCTGGCCACCCTCG
AAACGCGCCGCCACCGTTTCTTGCCCGATCCCTTCTGCCCGCACTGCGGAGCACTGCCCGAGGACTCGGC
GGACCGGGCCCAGCGCGTCCTGCGGCCCGCTGCGAAGATCACACCGTTCGGGTCCCGCACCCGCGACGTC
CTGGCCGACTTCGACACCATCCGCGAGCTGTACGTGGATCCGTTCAGCGGCCTGATCCGACGCACCGACC
GCGGCGCCGAGGGCGGGTTGGTGATGTCGGGCGCATCGATGCCGCTGCGGTTCGACAACCTCGCCGAGCC
CGGTTACGGCCGGAGCCGTGACTACCGGACCAGCGAGCTGACCGCGATCCTCGAAGCCCTGGAGCGCTAC
GGCGGCGTGGCTCCGGGGGGTCTGCAGACCTCCGTGCGCGGCACATTCCACGAACTCGCGCCACACGCCG
TGCACCCCGATGTGTTCGGCCGCCACCCCGACGAGAGCTACGACGACCCCTCCTTCCGCTATCGCAGGTT
CGACCCGGACCGGCCGCTGTGGTGGGTGTGGGCACACTCGTTCGCCACCGGAAACGCCCGCCTGGTGCCC
GAGGCGCTGGCGTACTACTACTGCCACCGCCTGCGCGGCGACGATCCGGTCTCCTACTACGAGGTGTCCA
ACGGCTGTGCCCTCGGCTCGTCCTGGGAGGAGGCGACGCTGCACGGGCTGATGGAGACGGTCGAGCGTGA
CGCCTTCCTGTGCACGTGGTACACCCGGACCGTCCCGCCGACGATCGACCTGGGCTCCTGCCACGACCCG
CGCGTTCCCCTCCAGGCGGGCGCGATCGGCTCGAGCACCGGCTACCGCATCCACGCCTTCGACATCACGA
CGGACTACGGGATCCCGGCGGTCTGGGTGATGGCCGCGCATCCGGACCGGAAGGGCCCCGCGCTGCTGTG
CACCGCGGGGGCCGGCCTGGATCCGGAGCGGGCCCTGCTGAACGCGTTGAACGAGCTCGGTCCGATCCTC
AGCGACGTGATCCGGCGCTATCCGGCCGAAGAGGAGCGAGCCGCGCAGATGGTGCGCGATCCGTACGGCG
TCGTCACCATGCCGGACCACTCCGCGCTCTACGCACATCCGGAGGCCGCGCACCGGCTCGACTTCCTGTT
CGACGGCCCGACCATCGGCATCGACGAGGTCGGCGGGCCGGACCGGCTGCGCCCGGACCGCGACGACCTC
ACGGTGGACCTGCGGGCCGCGGTCGAGCGCGTCGGCGAGGTGCTCGTGGTCGACCAGACCACGCCCGAAC
ACCGGGCCGGCGGCCTCACCTGTGTCAAGGTCCTCGTCCCCGGGGCGGTGCCGATGACCTTCGGCTACCG
CAACCGGCGCATCGACGGGCTGCCGCGGCTGCTGAGCCTGCCGCGACGGCTCGGCAGACTCGACGCGGGC
CTGACCCGGGCGCAGTTGAACCCCGACCCCCATCCGTTCCCGTGA
 Primer design

Protein Sequence:644 a.a.
>GetI|ThioFinder1395 Streptomyces sp. ATCC 55365
MTGTLTNTDREQAVQSGLLASSLSGAPALLGVEVRASDSWSLPADGPVDRPWLSVHTEVGQVIVGPLTRP
GVAGCPHCLDLRRQRVDASRPWLARLREEHGARLERDVPQLLDQLAAGVVADAAAALVADETAAGRPAGQ
PEVREPVGQDEPRLVAVIDLATLETRRHRFLPDPFCPHCGALPEDSADRAQRVLRPAAKITPFGSRTRDV
LADFDTIRELYVDPFSGLIRRTDRGAEGGLVMSGASMPLRFDNLAEPGYGRSRDYRTSELTAILEALERY
GGVAPGGLQTSVRGTFHELAPHAVHPDVFGRHPDESYDDPSFRYRRFDPDRPLWWVWAHSFATGNARLVP
EALAYYYCHRLRGDDPVSYYEVSNGCALGSSWEEATLHGLMETVERDAFLCTWYTRTVPPTIDLGSCHDP
RVPLQAGAIGSSTGYRIHAFDITTDYGIPAVWVMAAHPDRKGPALLCTAGAGLDPERALLNALNELGPIL
SDVIRRYPAEEERAAQMVRDPYGVVTMPDHSALYAHPEAAHRLDFLFDGPTIGIDEVGGPDRLRPDRDDL
TVDLRAAVERVGEVLVVDQTTPEHRAGGLTCVKVLVPGAVPMTFGYRNRRIDGLPRLLSLPRRLGRLDAG
LTRAQLNPDPHPFP