Home 

Gene Symbol:  
getH
Organism:  
Streptomyces sp. ATCC 55365
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
15641..17284 [1], 1644 bp
Product Function:  
GetH
Product Locus:  
 AEM00621.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1644 bp
>getH|ThioFinder1394 Streptomyces sp. ATCC 55365
ATGAGCACGATCCGGCGTGTGAACGCCTACACCATCGATCACGAGGGCAGGACCTACGGCCTGTCCGAGT
CGGGGCCGCTGGAGCTGTCGACCGGGCTGTCCGCCTGGATCCGTCTGGTGTCCTCCTGGGTCGATCAGGG
CCAGGACATCGAACAGGCCGCGGACGACCTGGGCGGCGCGCACGCCGGACAGGCCCGTCGGGTACGGGAC
GCGATGATGTCCGTGGGAGTCCTGCGGCGATTCGACGCCCCTGGTGAGGTCAGGTTCGTCGGCGAGCGCA
CGGACCTGATCCGCGCGGTGGAGCGCAGCGCGCCGGCCCTGCCGGACGTCGTCCTGGGTGCCGGCCCCCT
GTACGACGACTGGTTCGATGAGGTCCGGGCCGAGGCCGGAGCGGGCCGGGCGGGCGTCGTGCTCTTCACC
GAAGGCGCCGCCGTGGTCGCCGGGCCGATGGCCGCCGAGCAGCTCGAAGAGGTCGTGACGGCACTGCGCT
GCGGTGATCTCGCCGACGGGCGGCCCGGCCCGGACGTGATCCGGACGGCTGCCGCGCAGCTGGTCCGTCG
TGCCGCCCTCGGATCCGGTGACGAGTGGAGCGGCGTCATGATCACCCGGGAGGAGACCTCTTCCTGGCGG
GCGCTGCCGCACCCGTGGCGGCCGGCTCCCCCGGGCCCGGCTGCCGGGCCGTTCGACGAACGGGTGATGG
CGGCGATCGACCCGGTCCACGGCGTCGTGCGCGAGATCGGCGAGGACGACCTCCCCCAAGTGCCCCGGCA
CCTGGCGCGGGCCCGGGTCGCCGGACGGGCCACCGTCCGGCCGCTGGACCTGGACGTCGTGGCGGACGGC
TCGGACTACGCCCAGGCCCGGCGCCGGGCCGTGCTGGCCGCCGTCGCGCTGTACCTGGAGTCGACCCTCG
ACCCGCGCGCGGTGGTCGACGCCGAAGGGAAACGCGTCGTCGGCGACACCGCCGACCTGAGCGTGCTGCG
CGCCGCGACGGACCGCATCGCCGCCGACCCCGGACGCTGGTTCCTGCCCGCCCGCCGAGTGGTCGACGAC
AGCCGGTTGCTGGTCCCCGTCGACCGGGTGCGGCGCTGTGACGAGAGCGCCGGGCCGTCCTTGGGCACCG
CCGCGGCCGAGACACGGGACGACGCGCTCGCGACGGCGCTGCTCGACGTACTGGAGGCCTGGGCGGTGGG
GGCGACGAGCATGCTCGTGCGCATACGTGACGGAGAAGCGCTCCCTGCCGAAGTGCGCGAAGCTCTCGAC
CAGTTGCGGCTGAGTGATCGCGAAGCCTGGCTCGGCGTACTGCCGGACGGCGACGTCCCGACCGCCGTGG
CGACCACCAGGCACGGCACCGCCTACGCCTGCGGCACCAGCCACGCCGCCGCAGCGGTCCGCGCGATGGA
GCAGGCCGTGCTCGCCGACCAGGTGCTGATGCACGACCGCGCGGACCTCCTACCGCAGACCTGGGCTCCG
CCGGTCCCTAGGGCGGCCCGGGCCGTCGACCTGTCCGTCGCGGCGCCGATCACGCTCGCGGACCTGCGCC
GCGCCGTGGCGCTGCGCGCGCCGGACGCGGCCGTGGCCGAACTCGACCACGATGCCGGCATCGTCCGGCT
CGGAATATCGGCAGTGAAAGTGGTGGTGGACTGA
 Primer design

Protein Sequence:547 a.a.
>GetH|ThioFinder1394 Streptomyces sp. ATCC 55365
MSTIRRVNAYTIDHEGRTYGLSESGPLELSTGLSAWIRLVSSWVDQGQDIEQAADDLGGAHAGQARRVRD
AMMSVGVLRRFDAPGEVRFVGERTDLIRAVERSAPALPDVVLGAGPLYDDWFDEVRAEAGAGRAGVVLFT
EGAAVVAGPMAAEQLEEVVTALRCGDLADGRPGPDVIRTAAAQLVRRAALGSGDEWSGVMITREETSSWR
ALPHPWRPAPPGPAAGPFDERVMAAIDPVHGVVREIGEDDLPQVPRHLARARVAGRATVRPLDLDVVADG
SDYAQARRRAVLAAVALYLESTLDPRAVVDAEGKRVVGDTADLSVLRAATDRIAADPGRWFLPARRVVDD
SRLLVPVDRVRRCDESAGPSLGTAAAETRDDALATALLDVLEAWAVGATSMLVRIRDGEALPAEVREALD
QLRLSDREAWLGVLPDGDVPTAVATTRHGTAYACGTSHAAAAVRAMEQAVLADQVLMHDRADLLPQTWAP
PVPRAARAVDLSVAAPITLADLRRAVALRAPDAAVAELDHDAGIVRLGISAVKVVVD