Home 

Gene Symbol:  
getF
Organism:  
Streptomyces sp. ATCC 55365
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
13534..14283 [1], 750 bp
Product Function:  
putative aza-diels-alderase protein
Product Locus:  
 AEM00619.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:750 bp
>getF|ThioFinder1392 Streptomyces sp. ATCC 55365
ATGGCCGACCGCGCCGGGGTCGAGCTGCGCCAGGACTGGCTCGCGGACAACTCGCTCACCTGGACGACCG
GAGCCCTCGCCGCAACCGGCACTGCGGAAACGACCCTGCAGAGCCTGCTGGAGGACTTCCACTACGCGGC
GACCGTGCCGGCGCTGCGGCTGCTGAGTGCGGCTCCCGGCGAGCGGCTCGGCCTGGCCTGCGCCGACCTG
ATGGCGGTGACGGCCCAGGAGTTCGGCCGAGGTGGTCTGGTCTCGGCGGCGCTGTCCTTCCGCTCGCACG
CCGAGGCGTACCTGAACCTGGAGGCCGCGCCGGACGAGCGCGCGGCCTGGGACGCCGCCGCCCGCGCATC
GGCACCCGCGCTGCGCCGCCGACTGCTCGCGGTGGCGACCGGCCCGGACAGGCCCGCCTATGCCCGGGAC
TGGCTCGGGTTGATCACCCCGCTGGTCCGGGCCGCGGAGCAGGCCCAGCGACGGGGCGAACTCGCCCTGC
CCACCCTCGCCGAGGGCTTCAGCTCCGATCTGACCGAGCGCAGTGCCTTCCACCGTGGACTGGCCGGCTC
CACCTCCTGGGAGGACGTGCGCACCTCCGACTGGTTCGTGCTCTACCGCTTCGCGATCAACCTGCTCTAT
CTCCAGCTGTCCCGGCTCGGCGTCAAACCGGTCGGACGGTACCGACTGTGCCACCTGGTGGCCACGGCCC
TGGACCAACGGGAAGCTCCGACGACGACTGCCGAGGAGGGCGACTCGTGA
 Primer design

Protein Sequence:249 a.a.
>GetF|ThioFinder1392 Streptomyces sp. ATCC 55365
MADRAGVELRQDWLADNSLTWTTGALAATGTAETTLQSLLEDFHYAATVPALRLLSAAPGERLGLACADL
MAVTAQEFGRGGLVSAALSFRSHAEAYLNLEAAPDERAAWDAAARASAPALRRRLLAVATGPDRPAYARD
WLGLITPLVRAAEQAQRRGELALPTLAEGFSSDLTERSAFHRGLAGSTSWEDVRTSDWFVLYRFAINLLY
LQLSRLGVKPVGRYRLCHLVATALDQREAPTTTAEEGDS