Home 

Gene Symbol:  
Cp3995_1664
Organism:  
Corynebacterium pseudotuberculosis 3/99-5
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1776965..1777978 [1], 1014 bp
Product Function:  
Hypothetical protein
Product Locus:  
 YP_005123768.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1014 bp
>Cp3995_1664|ThioFinder1411 Corynebacterium pseudotuberculosis 3/99-5
ATGCGTACCACAGACCCCTGGCTGGCATTTCATATTTTTTATGGAGAAGACCCCTCTCACCTACTCCGCG
ACTGCTTATTACCTTTTGCTCATGCTTGCGTTGCAGAGGGGCTGGTAAGACGCTTCTTCCATATGAATTA
CTGGCTCGAAGGCGCTCATGTTCGCTTACGGTTAGAGCTGTCCAGCCCTGCGGATCGTGAGCGCGTCATA
TATAAAGCGCATCACGCTATCCAGCCATGGATCGATGCCCACCCTTCTAGTGCTCCCCAGTTGTCCTTGC
GTAATCCCGAAGGCTATCGGCGTCTTTTTGAACACGAATACCCTATGTCCAGGTTTTCTGATTACATCGA
TCAGGATGGCTTACCTCGCCTACAGCCAGATAACTGCATCCGAGAACGCTACTACGAGCGCGAATATGAC
CGCTATGGCGGGCCAGCAGGGATGTCACTTAGCCAAGACATTTTTCAAGCCTCCACATTGTTCGTCGAAA
AGCTTTTGCGCTCTGGAGTTGTAGAAGCCCGCACCTCGCGTTTAGCCACAGCTGCTCTAGGAATGGTCTG
CACCGCGCATACCTTTTTATCCTCCGACGAGTCCATAAGTATCTTTTGGGAGAGCTACCACCGTGGCTGG
ACTTCCTCTTTTTCCATCCCCACCAGCTACACTTCCCCCGCTGCACAACAAAAAATCGCAGCCGAGGCTC
AGGCGCTCTCCCGCGCAGTCACGCCGTTCCGCGATGCATTACACCGCTATCCAGACGGTTCTTCCCTCCC
CGAACCTTATGCAACTTTTACTCGGCATATGGCCTCTGTTGTTGAGAAACTCCATGCTGCTCATGCTGCT
CAAGAGTTGGATTTTGGAGATTCTGTGGCGGAGGCTGGCCACACGTGGAAAGAAAATTCCACTTTTCTTC
TGCGTTCTTATGTGCATATGACCAACAACAGGATGTCCGTCAATATCTCGGATGAGGCATATCTGGCTTA
TTTATTACAGAAGTTATATCGGGAGACGCCATGA
 Primer design

Protein Sequence:337 a.a.
>Cp3995_1664|ThioFinder1411 Corynebacterium pseudotuberculosis 3/99-5
MRTTDPWLAFHIFYGEDPSHLLRDCLLPFAHACVAEGLVRRFFHMNYWLEGAHVRLRLELSSPADRERVI
YKAHHAIQPWIDAHPSSAPQLSLRNPEGYRRLFEHEYPMSRFSDYIDQDGLPRLQPDNCIRERYYEREYD
RYGGPAGMSLSQDIFQASTLFVEKLLRSGVVEARTSRLATAALGMVCTAHTFLSSDESISIFWESYHRGW
TSSFSIPTSYTSPAAQQKIAAEAQALSRAVTPFRDALHRYPDGSSLPEPYATFTRHMASVVEKLHAAHAA
QELDFGDSVAEAGHTWKENSTFLLRSYVHMTNNRMSVNISDEAYLAYLLQKLYRETP