Home 

Gene Symbol:  
Cp3995_1663
Organism:  
Corynebacterium pseudotuberculosis 3/99-5
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1774362..1776965 [1], 2604 bp
Product Function:  
Lantibiotic dehydratase, N terminus/C terminus family
Product Locus:  
 YP_005123767.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2604 bp
>Cp3995_1663|ThioFinder1410 Corynebacterium pseudotuberculosis 3/99-5
ATGACAAACATTTCTTGGAAGCTCCTCGACGAAGGTCTCGTTCGTAGCTGCAGCTTGCCGTACACGGCAT
TGCTCCAGCTTTATGACGTCCCCACCAATGCATTACTTACTGCGGATCTAGCCCGACGGCGCCAGTTAAA
AGCAGCCTTCAAGTCCCTTGAAGCTACGGCGTGTCGGGAAGTCGCAGGATGCGTAGACGCAGTAGTGCGC
CATAAGCTACTTGATCTTAAGCGAGCCGCACATCAACATGATGCGACAAAAATTCACACAGTACTGACCA
AAATAAAAGCCGCGGGAATATCGTTGCCTGCTGCGGTACTGACTGCTGCCAATGCCGCAATCGCCGCTGC
AGAGAATGTGCTGTCTCCAGAGGTACTGCGCGAATTGCTTCTGCATTCCACTAAACAAGAACGCGCGCTT
CTGGGAAAAATCGTTAGAGAACAGGGAATCGATTCGGCAGTATCGGTTACGTCAGTCTCAGCAGCCAAAG
CCATCCGGAATCTAGGCATAGACCATAGGATGTCTGCTAAGCAGCTGGCTCGCGCGCATCGCACCGCGCT
AGGCTATGTGATCCGTAGCGCCACCCGGACAGTTCCTTTTTCTACTCTCTGTACAATTGCGCCTTTTCAG
TTTTCCCCTGCCAGCGCTCACCTGAGCGATCCCCACATCCCCGCCGCCACGCAGGCTATTGCCCAATGGA
ATGTGTACGCCATGTCTCAGATTTTTTCTGCGATAAAACAGGACTTTGAGCTCATCGCCACACTCCCGAT
CCGGGTTAACCCTGACGCGTTATCTGAAGATGCACACTGTGTGCTGCCACGGTGCTCTGTTGAATATTTA
GGACACGTCGGTGATCGAGACCTTGCTGTTTATCGGGAAGAGCGCCGGGTGGTGGATTCCCAGGGATTAT
TTGGAAAAGTTATGGCTTTGGCTGCAAGCGCTGCGGACAGCGGCGAATACACCTGCGGTCAGCTGGCAGC
AGAGCTTTCCGGTTGCACAGGGTTAAGTGCCTCCCAAGCGCAGTGCATTGTGCTGGATGCCATCCGCATT
TCGGCTTTAGTTGTTCCCGACCTAGATTTGTCTCCGTCCACAGCGGTTAGCCCTCAGCCGATAGTCGGGC
ACCTTGCACAAGGAACGGAAAAAGCCGTATCTGTCGCTCGGATTATTTCCCACATAGCAGCAGGATGCAA
AGTGGTGGCGTCGATACGCGCCTTTGAGCTCAAACATGCTCAGGTTCTAAAACTCACACGCCTTTTAGAA
AGTCTCAGGCAACTCGTCAACCCTGGCATCCCCGTGTTCCATACGTCTGTCTATGAAGATGGAGTGGGGA
AAGCATCAACGGTTTCTGCCCACGTAACAGAGTCTTGCAACGCTCTTGATTGGAGTACTCTCGCGCACCT
TGTGGATCTGCTTGATGTTAGGCAGGTAGAACGCTCCTTGTTTGAAAAGTTTGTGTCTGACAAATTTCCC
CGTGGGGAGATCTGCCACAACGTGCCGGCGGTGGTAAATGGTTTTGTTTCTGAGGTTCTCACGCCTCTGA
GACAAATTGACATTGAGGCAGTGAATGAAAACGATCTGAAATCCACTGCGGCTTTACCTCTAGGTAAGGC
TTGGAAATGGATCCGTGCTCGGCGTCATTTCCTAGCTCGCATAGCCGCGGTGAGAAGTAATGCCGCTGGC
CCCGTGGATGTACGTGCTCTTCTCAATGATTATCTTCCGCTCATGAGGTCTCGTACGTATCCATTTCGGT
CTTTGAACGCCTACGTTCAGCAAGACGCTGAGGGAGAACTCGTGATCAACCGTACGCTCGGGGGACCAGG
TTTTCCGTGGTCACGGTTTGCACACGCAATACCGGATTCCGCAGCTCATGCATGGTCCGAATTAGCAGAT
AGATCGTCTAACGCTGGAGTTCAGCTCGTAGAGCTAACGGCTGGCAAAGTAGTCTCCAACCTCAATGCCC
ATCCAGATACCTACCAGGCCTCCCTGATCATTCCAGGACATCCTAGGGAGTCCATAAAAACAAATGATAT
TCGTCTTGCAGACACCCAATTGACATATTGCGGGGCCAAAGGACGCTTACAGCTTTTCGACGCCCAAGGC
ACTGAGTTATTCCCCGCTTACATGGGGTACATCACCGACCGAGGCCTGCCATTATCTACACAAACTCTCA
TGCTCCTAGCGCCTCCCGCACATTGTTCCCTGGACTTTTTTCCTCCTCCAACTTCAGAGGTGGTGCGTCA
GGCTCGCCTCCTTCTGGGAGACGTTGTCATAGCAAGGGAAAGCTGGATCTTTCCTGTTTTATCCGCATCT
ATGAATATCCCTGACAGCCTAGAAGAGTCCCTAGTGTGGTGGCGCACTATGTCCCAGCATCATGAGCTCC
CCTCCTGCGGGGTACTGCGGACTTTTGATATCCGAGGAGGGGTGAATAAAGGGCAGTTTTATGATGCCCA
GATCATGGGGACAATCCTTAACCTCATACGAACACTGCGCAACGCTCACTACGGGTTTGTCATTGAAGAA
TTCTTTCCCCGCATTAGTTCATCCGACGTAGCACAGGAATACATAGTCACAGGAACACACGACTCTTTGA
AGGAGGGCATCTGA
 Primer design

Protein Sequence:867 a.a.
>Cp3995_1663|ThioFinder1410 Corynebacterium pseudotuberculosis 3/99-5
MTNISWKLLDEGLVRSCSLPYTALLQLYDVPTNALLTADLARRRQLKAAFKSLEATACREVAGCVDAVVR
HKLLDLKRAAHQHDATKIHTVLTKIKAAGISLPAAVLTAANAAIAAAENVLSPEVLRELLLHSTKQERAL
LGKIVREQGIDSAVSVTSVSAAKAIRNLGIDHRMSAKQLARAHRTALGYVIRSATRTVPFSTLCTIAPFQ
FSPASAHLSDPHIPAATQAIAQWNVYAMSQIFSAIKQDFELIATLPIRVNPDALSEDAHCVLPRCSVEYL
GHVGDRDLAVYREERRVVDSQGLFGKVMALAASAADSGEYTCGQLAAELSGCTGLSASQAQCIVLDAIRI
SALVVPDLDLSPSTAVSPQPIVGHLAQGTEKAVSVARIISHIAAGCKVVASIRAFELKHAQVLKLTRLLE
SLRQLVNPGIPVFHTSVYEDGVGKASTVSAHVTESCNALDWSTLAHLVDLLDVRQVERSLFEKFVSDKFP
RGEICHNVPAVVNGFVSEVLTPLRQIDIEAVNENDLKSTAALPLGKAWKWIRARRHFLARIAAVRSNAAG
PVDVRALLNDYLPLMRSRTYPFRSLNAYVQQDAEGELVINRTLGGPGFPWSRFAHAIPDSAAHAWSELAD
RSSNAGVQLVELTAGKVVSNLNAHPDTYQASLIIPGHPRESIKTNDIRLADTQLTYCGAKGRLQLFDAQG
TELFPAYMGYITDRGLPLSTQTLMLLAPPAHCSLDFFPPPTSEVVRQARLLLGDVVIARESWIFPVLSAS
MNIPDSLEESLVWWRTMSQHHELPSCGVLRTFDIRGGVNKGQFYDAQIMGTILNLIRTLRNAHYGFVIEE
FFPRISSSDVAQEYIVTGTHDSLKEGI