Home 

Gene Symbol:  
Cp3995_1661
Organism:  
Corynebacterium pseudotuberculosis 3/99-5
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1771589..1772860 [1], 1272 bp
Product Function:  
Uncharacterized protein ycaO
Product Locus:  
 YP_005123765.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1272 bp
>Cp3995_1661|ThioFinder1408 Corynebacterium pseudotuberculosis 3/99-5
GTGTTTATTCCGCCAAACCCATGCTGCGCTAAGCACCACACCTGGGTTGATAGCGCAAACCTTTCTGATC
TCACAGGGCCGGTGCTGGCACCATGCGGGGTGGGACCTAATACCGCGGTTCAGCGCCCTGGAATAGTTGT
TTCTCGTGGTACTGTGCCGGCCTTAGGCCCTCGACCGGCCTTCCACTGGAGTGGTCAGGCACCAACTATT
TCTGAGAGCCGAAAGCTGGCTCTCTTTGAGGCTGTCGAGCGAGCATCAGCATGCCAAAGAACTGGGAAGC
CAAGAGACTTCGGCACTCGTGTTCCGCGTGTTCCTGCGGCTGACTTTGGAGTAGAAAATACCCGGTGGAA
CCGTTCTTATGGTCGCTGTAAAGATTGGACAGAGGCAACTCGTCTGGGAGACGCAACTGAGTGGTCAATT
CCCACAGACATGGTGTTTTTCTGGTCTGACTCAAAAACTCGTTTTTGCTTTGATTCCTCCAACGGGGCTG
CGGTAGGACCCACTTGGGAGGACGCGGTTATGTCCGGGTTATTGGAGGTTATTGAACGTGACGCGGTTCT
AGCTGTATGGCACGGTTCTATGTCCGTTCCAGAGATTGACATTGGATCTATCAACGATCGTACTTATCGG
GCAATGCTGCGGAATCTTCACAGACAAGGGCTGGCTATCCGCGCGTTTTATTGTCCGCTCAGCGTGGGAG
TTCCCAGCGTTATTGCAGTGTGTACTGACGCCGCACGCACTTTCCTTTGCGTAGGGGCAGCGGCTGCGCC
CGACCCGAATGTCGCACTGCGCAAAGCGCTGAGGGAGGTCATGGCGGATTATCCGCAGTCGCGTTTGCTA
GCTGCTACGCAGATAACGGATGCCGCCGCAGCGCGTGCGGATGGTTCCGGGGCAGCTCACCGTTTAAGCG
TGACTGCCTCCGAGCTCATCCATGCCGCCGCTTTCTTACTGCTTCCTCGAAAAGAACTAGTCCGGGTCTC
CGATATCCCGGGACAACCACAGTTGTCTCTCAAAGAGTTAGTCGGATGTCTCAATGCTCATGGATTCCAT
GGCTATGTTGTTGATCTCACCGAGAGCTACCACCAAATGGTGGGGCTCACAGCTGTCAAGGTCATTGTTC
CGGGTCTTCTGCCGCTGGAATATATCGGACAACTTACTCGGGCTTTGCATATGCCGCGATTGAAACAACA
GATGACATGTTTTCGTGCTTTGGGTCTAACCTCTTCCAGCGCGAATCCCCGCCTCAATGTAGTTCCGCAT
CCGCTCCCCTAA
 Primer design

Protein Sequence:423 a.a.
>Cp3995_1661|ThioFinder1408 Corynebacterium pseudotuberculosis 3/99-5
MFIPPNPCCAKHHTWVDSANLSDLTGPVLAPCGVGPNTAVQRPGIVVSRGTVPALGPRPAFHWSGQAPTI
SESRKLALFEAVERASACQRTGKPRDFGTRVPRVPAADFGVENTRWNRSYGRCKDWTEATRLGDATEWSI
PTDMVFFWSDSKTRFCFDSSNGAAVGPTWEDAVMSGLLEVIERDAVLAVWHGSMSVPEIDIGSINDRTYR
AMLRNLHRQGLAIRAFYCPLSVGVPSVIAVCTDAARTFLCVGAAAAPDPNVALRKALREVMADYPQSRLL
AATQITDAAAARADGSGAAHRLSVTASELIHAAAFLLLPRKELVRVSDIPGQPQLSLKELVGCLNAHGFH
GYVVDLTESYHQMVGLTAVKVIVPGLLPLEYIGQLTRALHMPRLKQQMTCFRALGLTSSSANPRLNVVPH
PLP