Home 

Gene Symbol:  
CDB402_1843
Organism:  
Corynebacterium diphtheriae INCA 402
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2013462..2014475 [1], 1014 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_005128342.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1014 bp
>CDB402_1843|ThioFinder1429 Corynebacterium diphtheriae INCA 402
ATGCGTACAACCGACCCTTGGCTCGCTTTTCATATTTTTTATGGAGAAGACCCTTCTCTCTTGCTCCGCG
ACTGCCTGCTGCCTTTTGCTCATACATGCGTTGCAGAAGGACTGGTAAAACGATTTTTCCATATGAATTA
CTGGTTGGAGGGCGCACACGTCCGCTTAAGGCTAGAGCTTTGCAATCCGGCAGATCGCGAGCGCGTCGTA
TGCGCAGCGCATCAGGCTATCCAACCGTGGATTGACTCCCATCCTTCCAGCGCGCCCCAGCTGTCCCTGC
GCAATCCCGAAGGTTATCGGCGCCTCTTTGAACACGAGTACCCCATGTCCAGGTTCTCCGACTATATCGA
TCAGGATGGTCTGCCCCGTCTACAGCCAGATAACTGCATCCGAGAACGCTACTACGAGCGTGAATATGAC
CGCTACGGCGGACGGATAGGGATGTCGCTTAGCCAAGATGTTTTTCAAACCTCGACGTTGTTCGTCGAGA
AGCTTTTACACTCTGGCGTTTTAGAAGCACGTACCTCACGACTAGCCGCGGCTGCGCTAGGAATGATCTG
CACTGCGCATACAGTTTTGGCTTCCGACGCATCCATAAGACGTTTTTGGGAAAGCTATCACGCAGGCTGG
ATCTCATCTTTTTCTATGCCCACCAGCTACACCTCGCCCACGGCACAGCACAAAATCTCCGCCGAGGCTC
AGGCGCTCTCACGCGCAGCCACGCCATTTCGTGCGGCCTTGCGCCACGCCCCAGACGGTTCAAGTCTTCC
CGAACCCTATGCCACTTTTACTCAACGCATGACGTCTCTCGTGGGAAAACTCCACGATGCATATGATTCC
CGAGAGCTCGATTTTGGTGATTCTGCCGCAGAGGCCGGCCACACGTGGAAAGAAAATTCCATTTTTCTTC
TGCGCTCTTATGTCCATATGACCAACAACAGAATGTCCGTCAACATCTCGGATGAGGCCTATTTAGCTTA
TTTACTGCACACGTTATATCGGGAGGCGCTATGA
 Primer design

Protein Sequence:337 a.a.
>CDB402_1843|ThioFinder1429 Corynebacterium diphtheriae INCA 402
MRTTDPWLAFHIFYGEDPSLLLRDCLLPFAHTCVAEGLVKRFFHMNYWLEGAHVRLRLELCNPADRERVV
CAAHQAIQPWIDSHPSSAPQLSLRNPEGYRRLFEHEYPMSRFSDYIDQDGLPRLQPDNCIRERYYEREYD
RYGGRIGMSLSQDVFQTSTLFVEKLLHSGVLEARTSRLAAAALGMICTAHTVLASDASIRRFWESYHAGW
ISSFSMPTSYTSPTAQHKISAEAQALSRAATPFRAALRHAPDGSSLPEPYATFTQRMTSLVGKLHDAYDS
RELDFGDSAAEAGHTWKENSIFLLRSYVHMTNNRMSVNISDEAYLAYLLHTLYREAL