Home 

Gene Symbol:  
CDB402_1842
Organism:  
Corynebacterium diphtheriae INCA 402
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2010862..2013462 [1], 2601 bp
Product Function:  
lantibiotic dehydratase domain-containing protein
Product Locus:  
 YP_005128341.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2601 bp
>CDB402_1842|ThioFinder1428 Corynebacterium diphtheriae INCA 402
ATGACAACTACTTCATGGAAACTTCTTAATGAAGCCCTGGTTCGCAGCTGCAGTGTGCCGTATGAGGCGT
TACGCCAGCTTTGCGACGCCCCCACCGACGCACTACTTACTGCCGATCTGGACCAGCGACTCCGCGTAAA
CGCGGCCCTTGATGCCCTTGGGTCTGCGGCCCATCAGGACGTCGCGGGGTGCACAAACACAGTGTTGCGT
CGGGCTCTACTCGATCTCAAGCGAGCTGCACATCATCATGACGTGCGCAAAGTTCGTGCCCTGCTGGCTA
AAGCTACATCCGCTGGTGTGCGGTTGCCTGCTGGCGTAACGGCTGCCGCAGATACGGTGATCACTGCCGC
CGAAAACGTGCTGTCCTCAGAGCAGCTGCACAAGGTACTCATGAGTTCCAAGAAAAGAGAGCGCGAGTGC
CTCGGGAAGATTGCCCGTGACTGGGGAGTCGATTCAGCAGTACTGGCTGCATCAGTCCCAGCGGCAAAAG
CCATCCGGAAACTGAGCACAGATTGTGCGCTGTCTGCCAAGCAGCTAGCTCGTGCCCACCGCACCGCGCT
GGGATACGTGATCCGCAGCGCCACCCGGTCAGTACCGTTTTCCGCCCTGTGCGCAATCGCGCCGTCTCAG
TTGTCCCACGCCAGCCTACACTCGGATGAGACTCTTGCCCCAACATCTGTGCACACTATTGCGCGTTGGA
ACGTCTACGCCATGGCTCAGATTTTCTCTGCTATGAAGAAGGACTTTGGTTTTATTGCCACACTTCCGGT
TCTGGTTAATCCTGACGCGTTATCAGAGCATGGTCACTGCGTACTGCCTCGGTGTTCTGTCGAATATCTA
GGGCACGTCGGCGACCGGGACTTGGCCGTTTACCGGGAGGAACGCCGAGTGGTCGATTCCAATGGACTAT
TTGGAAAGGTCATGGCCTTAGCCACAAGTGCTCCCCAAAACCACGAATACACGTGTGAGCAGCTGGCCGC
AGAGCTCTCGGCGCGTACAGGTTTAAGCAAGGCACAAACAAAGTGCATTGTTCTCGATGCCATCCGAATT
TCGGCCTTAGTTGTTCCCACTCTCGATTTATCCCCGTCCACAGCGGTATCTGAACAGCCGATAGTTACGC
ACTTGGCACGTGGGTCGGACAAGGCCGTATCTGCTGCGCGTCTCATTGCCCGCATCACGGAGGAATGCAA
CGCGGTGGCGTCGATAAGCGACTTTGACCGCAGGCACACTCAGATCCTAGATCTCGCGCACCACCTGGAT
AGCCTGCGGCGACTCGTCGATCCCAGCATGCCGGTGTTCCATACCCATGTGTATGAGGATGGGGTCGGGA
AAGAATCGACGATTCCCTCCTCCATCGTGGACTCGTGCACAGCCCTTGACTGGGAAGCTCTCGCAGACCT
AGTCGATCTGCTTGATGTGCGGCAGGCAGAACGCGCGTTGTTTGAGGAGTTTGTGTCCGCAAAATTCCCC
CGTGGGGAAATCTGCCACGATGTTCCGGCGGTGGTCAATAGTTTTGTCTCCGAGGTCCTCACACCCCTGC
GGCAGGTTGATATTGAGGCAGTTGATGAAAATGACCTGAAGTCCACTGCATCGTTGCCACTGGGTAAGGC
ATGGGAATGGATTCGGGCGCGGCGCCGCTTCCTGGCACACGTAACCGAGTTAAGAAACAACGCCGCTGGT
CCCGTGGATATACGGAATCTTCTCACCAACTATCGTCCACTTGTGCAGTCTCGTAGGTATCCGCTTCGAT
CTTTAAACGTATACGTTCAGCAAGGCGACGAGGCCAAAGTCGTGATTAACCGGACGCTCGGCGGCCCAGG
CTTCCCGTGGTCTCGGTTCGCGCATGCGATGCCGGATTCCGCAGCACGCGCATGGTCCGAATTATCGGAT
TATGCGTCTGACGCTGGGGTGACGCTTGTCGAGTTGACAGCCGGAAAAGTGGTCTCCAACCTCAACGCAC
ATCCGGCCACCTACCCAACCACTCTCCTCATCCCAGGGCATCCTCGAAAAACCACACGGTCGTCTGATAT
TCGACTCGCAGACACGCAGTTGGCCTACTGCGCATCCAGCGGACGCTTGCAGCTTTTCGACGCCCACGGC
ACCGAACTCCTCCCCGCATACATGGGATACATCACTGACCGGGGACTGCCATTATCTACACAAGCCCTCA
TGCTCCTAGCACCACCCATGCATTGTTCCTTGGACTTTTTCCCGCGCACGAGTTCAGAGATAGTGCATCA
GGCTCGTCTACTCCTAGGAGATGTTGTTCTTGCGCGAGAAAGCTGGATTTTTCCCACCTCAAGCACCTCT
ATGGATATTCCGTGTCTCCTAGAAGAGGCACTGGTGTGGTGGCGCAGCATTGCCCGACATCACGACCTAC
CCGAGTGCGGAGTTCTGCGAACATTCGATGCCCACGGCGTTGTGGGTAAAGGACAGTTTTATAACTCCCA
AATCATGGGAACGATCACCAACCTCATACGCGCATTGCGCAACGCTCACTACGGGTTTGTGATTGAGGAA
TTCTTTCCCCACGTCGGCGCGTCCGGTGTAGCACAGGAATACATAGTAACAGGAACGCGCTCTTTGAAGG
AGGGTATCTAA
 Primer design

Protein Sequence:866 a.a.
>CDB402_1842|ThioFinder1428 Corynebacterium diphtheriae INCA 402
MTTTSWKLLNEALVRSCSVPYEALRQLCDAPTDALLTADLDQRLRVNAALDALGSAAHQDVAGCTNTVLR
RALLDLKRAAHHHDVRKVRALLAKATSAGVRLPAGVTAAADTVITAAENVLSSEQLHKVLMSSKKREREC
LGKIARDWGVDSAVLAASVPAAKAIRKLSTDCALSAKQLARAHRTALGYVIRSATRSVPFSALCAIAPSQ
LSHASLHSDETLAPTSVHTIARWNVYAMAQIFSAMKKDFGFIATLPVLVNPDALSEHGHCVLPRCSVEYL
GHVGDRDLAVYREERRVVDSNGLFGKVMALATSAPQNHEYTCEQLAAELSARTGLSKAQTKCIVLDAIRI
SALVVPTLDLSPSTAVSEQPIVTHLARGSDKAVSAARLIARITEECNAVASISDFDRRHTQILDLAHHLD
SLRRLVDPSMPVFHTHVYEDGVGKESTIPSSIVDSCTALDWEALADLVDLLDVRQAERALFEEFVSAKFP
RGEICHDVPAVVNSFVSEVLTPLRQVDIEAVDENDLKSTASLPLGKAWEWIRARRRFLAHVTELRNNAAG
PVDIRNLLTNYRPLVQSRRYPLRSLNVYVQQGDEAKVVINRTLGGPGFPWSRFAHAMPDSAARAWSELSD
YASDAGVTLVELTAGKVVSNLNAHPATYPTTLLIPGHPRKTTRSSDIRLADTQLAYCASSGRLQLFDAHG
TELLPAYMGYITDRGLPLSTQALMLLAPPMHCSLDFFPRTSSEIVHQARLLLGDVVLARESWIFPTSSTS
MDIPCLLEEALVWWRSIARHHDLPECGVLRTFDAHGVVGKGQFYNSQIMGTITNLIRALRNAHYGFVIEE
FFPHVGASGVAQEYIVTGTRSLKEGI