Home 

Gene Symbol:  
CDB402_1841
Organism:  
Corynebacterium diphtheriae INCA 402
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2009381..2010865 [1], 1485 bp
Product Function:  
Nitroreductase
Product Locus:  
 YP_005128340.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1485 bp
>CDB402_1841|ThioFinder1427 Corynebacterium diphtheriae INCA 402
ATGGATCGCCATACTGCAGATTTTTGGGCCACAACGGATAACGCTGCGACCGAATACACGCAGCTCATTT
TGGAGCGCAAAGAACATGGCATGGTCTTCCCTGCTCAAGGTCCCTTTTGGAACCATCAACCCTATCCCGC
AAAAATTGTTCCAGACGCCCCTCGTTTCCAGCTTCATACACACGCTATGTCCCCCACGGACATCGCTATT
GCGCAAGCGCTGGAGGATTCTCTGATCAGAACTCATCTGCGCGCAGAAGTCGACTGCAACTCGCCGACAA
GGACCCGATCTGAGGCGCAATCTTTTCAGTGGTCTCGGAATACAGCCTCAGGCGGAGGCTTATACCCAGT
GAACGTCTACAGATACAGCCCCGGAGATAGCCACCTGCCCGCTGGCCTGTACTTATTCAACCCCATAACC
TGCCAATGGCAGCAGTTGAGGGCTGATTCCCCACGAGGCGAACACTCGCGTTCTGCCGGTGAGACCCTGC
TGGTTACCGTGGAGTTTTGGCGTTCAGCGTTTAAGTACGGTGACTTTGCGTATCAAGCGACCTCCGTGGA
TGTGGGGATCGTTGTCGCGGCGTTAGTCTCCCAACTGGATGCAGCTGTTGGGCCGGTGGCGATCGACTGG
TCACCCGACGAGCTTGCTCTCTCCGAATTCCTTGGTAGTGATCCCCTCGACGAGGCCATATATTGCACGA
TCACGCTGCCTAACGGCTCCCCTTCAGACACTGTTACCGCTGGCGTGCCATCAGCCGTTCTCCAGACTGC
TGCTCGACTCGCGCACTCGGGAACGATGCCCGTACGTTTTCCTACCACTGTGGCTTTGCAAAAACAGCGG
CTCCGAGAAATGCAGAGTATGCGTGCGCCTTTTTCTACGGAAAGAATCGCCGCCCCGCCACCAGCAATAA
TCAAGCGAGGGTCCAGCTCTTTTGGGCGCTATTCCGGAGCTCCAATCGACGTGGGTGTGCTTACTCGCAT
GGTGCAACGCGGGCGTGCCACGGCCGCTTCACTCCTGGGAACCCCTCCTGAAACTGATTATTTCTTGGGT
ATCCAAGCAGCCGCGCTGTGTGTCAACGTCACGGGCTTAGCACATTCTCTTATAGCGGATAGTGAGACAT
ATCCTGCGTCGGCTCCTGCGCGCCCGTGTCCACAGCTTCCCGAGTTATTGCGCAACACCTATCTCCTGAA
AAACTACGACCCCCTGCGCAGCTCAGCCGTCTTAGTGCTGTGCGCAGATTTGCAGCGGGTAACCACTACT
TACGGCGCCTCTGGTTATCGGTGGGCATGTGCTGAGGTCGGGGCCTTTTGTCACGCTGTCTATGCTGTAG
CGGCACAGGAACGGGTCTCTGTGGGCGCTGTGTTGGGGTTTGATGCTCAGTACCAGCGCGACTACCTCGG
TTTAGCAGATAACCTCGTCCCGATCCTCAACATTCTTGTGGGTGTGGATCGGCCTCATGCACGGTGGAGG
AACTCGTTACTATGA
 Primer design

Protein Sequence:494 a.a.
>CDB402_1841|ThioFinder1427 Corynebacterium diphtheriae INCA 402
MDRHTADFWATTDNAATEYTQLILERKEHGMVFPAQGPFWNHQPYPAKIVPDAPRFQLHTHAMSPTDIAI
AQALEDSLIRTHLRAEVDCNSPTRTRSEAQSFQWSRNTASGGGLYPVNVYRYSPGDSHLPAGLYLFNPIT
CQWQQLRADSPRGEHSRSAGETLLVTVEFWRSAFKYGDFAYQATSVDVGIVVAALVSQLDAAVGPVAIDW
SPDELALSEFLGSDPLDEAIYCTITLPNGSPSDTVTAGVPSAVLQTAARLAHSGTMPVRFPTTVALQKQR
LREMQSMRAPFSTERIAAPPPAIIKRGSSSFGRYSGAPIDVGVLTRMVQRGRATAASLLGTPPETDYFLG
IQAAALCVNVTGLAHSLIADSETYPASAPARPCPQLPELLRNTYLLKNYDPLRSSAVLVLCADLQRVTTT
YGASGYRWACAEVGAFCHAVYAVAAQERVSVGAVLGFDAQYQRDYLGLADNLVPILNILVGVDRPHARWR
NSLL