Home 

Gene Symbol:  
CDB402_1840
Organism:  
Corynebacterium diphtheriae INCA 402
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2007795..2009345 [1], 1551 bp
Product Function:  
Uncharacterized conserved protein
Product Locus:  
 YP_005128339.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1551 bp
>CDB402_1840|ThioFinder1426 Corynebacterium diphtheriae INCA 402
ATGACTACGCGCGTCGCCTACCTGTACTGCCCGGCGCGCAGTTTCCCAGCGCACGCCCTGCCTCCGCGTC
ATGAGCAGTGGATAGCAGTCCCCTCCAAGGTGTGCAGGGTCTGCCTTAACGCATGGGTGGATCGCACGGA
AGAGGCTGCGGACTGGGTTAAGGCTGCTAGAGTACCCGGCTTCATCAGACGTTGGCTGTCTGAGCGTGTG
CACTACGTCGAGCACCCCTTGGGAGGTTGGAGACTAGCAGCTACTGATGCGCAGTGCCTCTCCAGTTCTA
CGGTATTTATTCCGCCAAGCCCGTGCTGCACTGAGCACCACGATTGTGCTGCTAACGCAGAGGTTTCCGA
TCTCACAGGGCCTGTGTTAGCACCGTGTGGGACGGGGCCGATCACGGAGATTCGCCGTCCTGGAATGGTG
GTTTCCCGTGGAACCATGCCTACTGTGGGGTCTCGACCAGCATTCCATTGGAGTGGTCAGGCGCCGACCA
TTGCTGAGAGCCGAAAGCTGGCTCTTTGTGAGGCCGTCGAGCGCGCATCCGCATGTGGGAATGAGGGAGC
GGGAGGCGTCGATACGCATATTCCCCACGTCCCTGCCACTGATTTTGGGGTGGACAACGAACGGTGGAAC
CGTTCTTACGATCACTGCCGCAATTGGACACGCGCTATTCGCCTGGGAGATGAAACTGCATGGGCAGTCC
CCACGGATATGGCGTTTTTCTGGTCTGACGCACAAGCTCGTTTTTGCTTCGATTCCTCCAGCGGCGCCGC
GGTGGGGCGCACATGGGAGGACGCGGTGATGTCTGGGTTAGTAGAGGTCATTGAACGTGACGCTGTCTTG
GCGGTATGGCATGGTTCCATGACCGTCCCAGAGATCGATGTTGACTCGATCAATGATCGCACTTACCAGG
CAATGCTGCGGCATCTTCGCAGGCAAGGGCTGGTTATCCGCGCGTTTTACTGCCCGCTGAGTGTAGGAGT
TCCTGCTGTTATTGCGGTATGCATGGATACTGAGCGCACTTTCCTCTGTGTTGGGGCAGCCGCCGCACCC
GATCCCTATGTCGCAGTACGCAAAGCTCTACGGGAGGTCATGGCGGATTATCCGCAGTCGCGTTTGCTTT
CTAGTACACGGTTGTCAGACGCTGCCGCAGTGCGTGCGGACGGTTCCGGGGCAGCTCATCGCCTCAGCGT
TGCCGCTTCCGAGCTTATCGACGCCGCCGCTTTCCTCCTCCTGCCCCGTAAAGAGCTGCTCCGTGTCTCC
GACATCCCGAGGTGCCCTCGATTGTCTCTCGTTGAGCTAGTCGAGCGTCTCAAAGCACATGGCTTTTACG
GCTATGTTGTCGACTTCACCCAGAGTTATCACCAAATGGTGGGGCTTTCAGCTGTCAAGGTTATTGTCCC
TGGTCTCTTGCCGCTGGAATATATCGGACAGCTGACTAGGGCATTGCATATGCCTAGGTTGAGGCAACAG
ATGACATGTTTTCGCGCTTTGGGCCTAGCTCCTCCCAGCTCACCTCCCCGTCTCAATCTTGTTCCGCACC
CGCTTCCCTAA
 Primer design

Protein Sequence:516 a.a.
>CDB402_1840|ThioFinder1426 Corynebacterium diphtheriae INCA 402
MTTRVAYLYCPARSFPAHALPPRHEQWIAVPSKVCRVCLNAWVDRTEEAADWVKAARVPGFIRRWLSERV
HYVEHPLGGWRLAATDAQCLSSSTVFIPPSPCCTEHHDCAANAEVSDLTGPVLAPCGTGPITEIRRPGMV
VSRGTMPTVGSRPAFHWSGQAPTIAESRKLALCEAVERASACGNEGAGGVDTHIPHVPATDFGVDNERWN
RSYDHCRNWTRAIRLGDETAWAVPTDMAFFWSDAQARFCFDSSSGAAVGRTWEDAVMSGLVEVIERDAVL
AVWHGSMTVPEIDVDSINDRTYQAMLRHLRRQGLVIRAFYCPLSVGVPAVIAVCMDTERTFLCVGAAAAP
DPYVAVRKALREVMADYPQSRLLSSTRLSDAAAVRADGSGAAHRLSVAASELIDAAAFLLLPRKELLRVS
DIPRCPRLSLVELVERLKAHGFYGYVVDFTQSYHQMVGLSAVKVIVPGLLPLEYIGQLTRALHMPRLRQQ
MTCFRALGLAPPSSPPRLNLVPHPLP