Home 

Gene Symbol:  
CDCE8392_1866
Organism:  
Corynebacterium diphtheriae CDCE 8392
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1969407..1970420 [1], 1014 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_005134400.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1014 bp
>CDCE8392_1866|ThioFinder1446 Corynebacterium diphtheriae CDCE 8392
ATGCGTACAACCGACCCCTGGCTCGCTTTTCATATTTTTTATGGAGAAGACCCTTCTCTCTTGCTCCGCG
ACTGCCTGCTGCCTTTTGCTCATACATGCGTTGCAGAAGGACTGGTAAAACGATTTTTCCATATGAATTA
CTGGTTGGAGGGCGCACACGTCCGCTTAAGGCTAGAGCTTTGCAATCCGGCAGATCGCGAGCGCGTCGTA
TGCGCAGCGCAACAGGCTATCCAACCGTGGATTGACTCCCATCCTTCCAGCGCGCCCCAGCTGTCCCTGC
GCAATCCCGAAGGTTATCGGCGCCTCTTTGAACACGAGTACCCCATGTCCAGGTTCTCCGACTATATCGA
TCTGGATGGTCTGCCCCGTCTACAGCCAGATAACTGCATCCGAGAACGCTACTACGAGCGTGAATATGAC
CGCTACGGCGGACGGATAGGGATGTCGCTTAGCCAAGATGTTTTTCAAACCTCGACGTTGTTCGTCGAGA
AGCTTTTACACTCTGGCGTTTTAGAAGCACGTACCTCACGACTAGCCGCAGCTGCGCTAGGAATGATCTG
CACCGCGCATACAGTTTTGGATTCCGACGCAGCCATAGGACGCTTTTGGGAAAGCTATCACGCAGGTTGG
ACCTCGTCTTTTTCCATGCCCACCAGCTACACCTCGCCCACGGCACAGCACAAAATCGCCACCGAGGCTC
AGGCGCTCTCACGTGCAGCCACGCCATTTCGTGCGGCCTTGCGCCACGCCCCAGACGGTTCAAGTCTTCC
CGAACCCTATGCCACTTTTACTCAACGCATGACGTCTGCAGTGGAGAAACTCCATGCGGCACATGCCTCT
CACGAGCTTGATTTTGGTGATTCTGCGGCAGAGGCTGGCCACACGTGGAAAGAGAACTCCATTTTTCTTC
TGCGCTCCTATGTCCATATGACCAACAACAGAATGTCCGTCAATATCTCGGATGAGGCCTATTTAGCTTA
TTTACTGCACGCGTTATATCAGGAGTCATTATGA
 Primer design

Protein Sequence:337 a.a.
>CDCE8392_1866|ThioFinder1446 Corynebacterium diphtheriae CDCE 8392
MRTTDPWLAFHIFYGEDPSLLLRDCLLPFAHTCVAEGLVKRFFHMNYWLEGAHVRLRLELCNPADRERVV
CAAQQAIQPWIDSHPSSAPQLSLRNPEGYRRLFEHEYPMSRFSDYIDLDGLPRLQPDNCIRERYYEREYD
RYGGRIGMSLSQDVFQTSTLFVEKLLHSGVLEARTSRLAAAALGMICTAHTVLDSDAAIGRFWESYHAGW
TSSFSMPTSYTSPTAQHKIATEAQALSRAATPFRAALRHAPDGSSLPEPYATFTQRMTSAVEKLHAAHAS
HELDFGDSAAEAGHTWKENSIFLLRSYVHMTNNRMSVNISDEAYLAYLLHALYQESL