Home 

Gene Symbol:  
CDCE8392_1865
Organism:  
Corynebacterium diphtheriae CDCE 8392
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1966807..1969407 [1], 2601 bp
Product Function:  
lantibiotic dehydratase domain-containing protein
Product Locus:  
 YP_005134399.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2601 bp
>CDCE8392_1865|ThioFinder1445 Corynebacterium diphtheriae CDCE 8392
ATGACAACTACTTCATGGAAACTTCTTAATGAGGCTTTGGTTCGCAGCTGCAGTGTGCCGTATGAGGCGT
TACACCAGCTTTGCGACGCCCCCACCGACGCACTGCTTACTGCCGATCTGGACCAGCGACTCCGCGTAAA
CGCGGCCCTTGATGCCCTTGGTTCTGCGGCCCATCAGGACGTCGCGGGGTGCACAAACACAGTGTTGCGT
CGGGCTCTACTCGATCTCAAGCGAGCTGCACATCATCATGACGTGCGCAAAGTTCGTGCCCTGCTGGCTA
AAGCTACATCCGCTGGTGTGCGGTTGCCTGCTGGCGTAACGACTGCCGCAGATACGGTGATCACTGCCGC
CGAAAACGTGCTGTCCTCAGAGCAGCTGCACAAGGTACTCATGAGTTCCAAGAAAAGAGAGCGCGAGTGC
CTCGGGAAGATCGCCCGTGACTGGGGAGTCGATTCAGCAGTACTGGCTGCATCAGCCCCAGCGGCAAAAG
CCATCCGGAAACTGAGCACAGATTGTGAGCTGTCTGCCAAGCAGCTAGCTCGTGCCCACCGCACCGCGCT
GGGATACGTGATCCGCAGCGCCACCCGGTCAGTACCGTTTTCCGCCCTGTGCGCAATCGCGCCGTCTCAG
TTGTCCCACGCCAGCCTACACTCGGATAAGACTCTTGCCCCAACATCTGTGCACACTATTGCGCGTTGGA
ACGTCTACGCCATGGCTCAGATTTTCTCTGCTATGAAGAAGGACTTTGGTTTTATTGCCACACTTCCGGT
TTTGGCTAATCCTGACGCGTTATCAGAGCATGGTCACTGCGTACTGCCTCGGTGTTCTGTCGAATATCTA
GGGCACGTCGGCGACCGGGACTTGGCCGTTTACCGGGAGGAACGCCGAGTGGTCGATTCCAATGGACTAT
TTGGAAAGGTCATGGCCTTAGCCACAAGTGCTCCCCAAAACCACGAATATACGTGTGAGCAGCTGGCCGC
AGAGCTCTCGGCGCGTACAGGTTTAAGCAAGGCACAAACAAAGTGCATTGTTCTCGATGCCATCCGAATT
TCGGCCTTAGTTGTTCCCACTCTCGATTTATCCCCGTCCACAGCGGTATCTGAACAGCCGATAGTTACGC
ACTTGGCACGTGGGTCGGACAAGGCCGTATCTGCTGCGCGTCTCATTGCCCGCATCACGGAGGAATGCAA
CGCGGTGGCGTCGATAAGCGACTTTGACCGCAGGCGCACTCAGATCCTAGATCTCGCGCACCACCTGGAT
AGCCTCCGGCGACTCGTCGATCCCAGCATGCCGGTGTTCCATACCCATGTGTATGAGGATGGGGTCGGGA
AAGAATCGACGATTCCCTCCTCCATCGTGGACTCGTGCACAGCCCTTGACTGGGAAGCCCTCGCAGACCT
AGTCGATCTGCTTGATGTGCGGCAGGCAGAACGCGCGTTGTTTGAGGAGTTTGTGTCCGCAAAATTCCCC
CGTGGGGAAATCTGCCACGATGTTCCGGCGGTGGTCAATAGTTTTGTCTCCGAGGTCCTCACGCCCCTGC
GGCAGGTTGATATTGAGGCAGTTGATGAAAATGACCTGAAGTCCACTGCATCGTTGCCACTGGGTAAGGC
ATGGGAATGGATTCGGGCGCGGCGCCGCTTCCTAGCACACGTAACCGAGTTAAGAAACAACGCCGCTGGT
CCCGTGGATATACGGAATCTCCTCACCAACTATCGTCCACTTGTGCAGTCTCGTAGGTATACGCTTCGAT
CTTTAAACGTATACGTTCAGCAAGGCGACGAGGCCAAAGTCGTGATTAACCGGACGCTTGGCGGCCCAGG
CTTCCCGTGGTCTCGGTTCGCGCATGCGATGCCGGATTCCGCAGCACGCGCATGGTCCGAATTATCGGAT
TATGCGTCTGACGCTGGGGTGACGCTTGTCGAGTTGACAGCCGGAAAAGTGGTCTCCAACCTCAACGCAC
ATCCGGCCACCTACCCAACCACTCTCCTCATCCCAGGGCATCCTCGAAAAACCACACGGTCGTCTGATAT
TCGACTCGCAGACACGCAGTTGGCCTACTGCGCATCCAGCGGACGCTTGCAGCTTTTCGACGCCCACGGC
ACCGAACTCCTCCCCGCATACATGGGATACATCACTGACCGGGGACTGCCATTATCTACGCAAGCCCTCA
TGCTCCTAGCGCCACCCATGCATTGTTCCTTGGACTTTTTCCCGCGCACGAGTTCAGAGATAGTTCATCA
GGCTCGTCTACTCCTAGGAGATGTTGTTCTTGCGCGAGAAAGCTGGATTTTTCCCACCTCAAGCACCTCT
ATGGATATTCCGTGTCTCCTAGAAGAGGCACTGGTGTGGTGGCGCAGCATTGCCCGACATCACGACCTAC
CCGAGTGCGGAGTTCTGCGAACATTCGATGCCCACGGCGTTGTGGGTAAAGGACAGTTTTATAACTCCCA
AATCATGGGAACGATCACCAACCTCATACGCGCATTGCGCAACGCTCACTACGGGTTTGTGATTGAGGAA
TTCTTTCCCCACGTCGGCGCGTCCGGTGTAGCACAGGAATACATAGTAACAGGAACGCGCTCTTTGAAGG
AGGGTATCTAA
 Primer design

Protein Sequence:866 a.a.
>CDCE8392_1865|ThioFinder1445 Corynebacterium diphtheriae CDCE 8392
MTTTSWKLLNEALVRSCSVPYEALHQLCDAPTDALLTADLDQRLRVNAALDALGSAAHQDVAGCTNTVLR
RALLDLKRAAHHHDVRKVRALLAKATSAGVRLPAGVTTAADTVITAAENVLSSEQLHKVLMSSKKREREC
LGKIARDWGVDSAVLAASAPAAKAIRKLSTDCELSAKQLARAHRTALGYVIRSATRSVPFSALCAIAPSQ
LSHASLHSDKTLAPTSVHTIARWNVYAMAQIFSAMKKDFGFIATLPVLANPDALSEHGHCVLPRCSVEYL
GHVGDRDLAVYREERRVVDSNGLFGKVMALATSAPQNHEYTCEQLAAELSARTGLSKAQTKCIVLDAIRI
SALVVPTLDLSPSTAVSEQPIVTHLARGSDKAVSAARLIARITEECNAVASISDFDRRRTQILDLAHHLD
SLRRLVDPSMPVFHTHVYEDGVGKESTIPSSIVDSCTALDWEALADLVDLLDVRQAERALFEEFVSAKFP
RGEICHDVPAVVNSFVSEVLTPLRQVDIEAVDENDLKSTASLPLGKAWEWIRARRRFLAHVTELRNNAAG
PVDIRNLLTNYRPLVQSRRYTLRSLNVYVQQGDEAKVVINRTLGGPGFPWSRFAHAMPDSAARAWSELSD
YASDAGVTLVELTAGKVVSNLNAHPATYPTTLLIPGHPRKTTRSSDIRLADTQLAYCASSGRLQLFDAHG
TELLPAYMGYITDRGLPLSTQALMLLAPPMHCSLDFFPRTSSEIVHQARLLLGDVVLARESWIFPTSSTS
MDIPCLLEEALVWWRSIARHHDLPECGVLRTFDAHGVVGKGQFYNSQIMGTITNLIRALRNAHYGFVIEE
FFPHVGASGVAQEYIVTGTRSLKEGI