Home 

Gene Symbol:  
CDCE8392_1864
Organism:  
Corynebacterium diphtheriae CDCE 8392
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1965326..1966810 [1], 1485 bp
Product Function:  
Nitroreductase
Product Locus:  
 YP_005134398.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1485 bp
>CDCE8392_1864|ThioFinder1444 Corynebacterium diphtheriae CDCE 8392
ATGGATCGCCATACTGCAGATTTTTGGGCCACAACGGATAACGCTGCGACCGAATACACGCAGCTCATTC
TGGAGCGCAAAGAACATGGCATGGTCTTCCCTGTTCAAGGCCCCTTTTGGAACCATCAACCCTATCCCGC
AAAAATTGTTCCAGACGCCCCTCGTTTCCAGCTTCATACACACGCCATGTCCCCCACGGACATCGCTATT
GCGCAAGCGCTGGAGGATTCTCTGATCAGAACTCATCTGCGCGCAGAAGTCGACTGCAACTCGCCGACAA
GGACCCGATCTGAGGCGCAATCTTTTCAGTGGTCTCGGAATACAGCCTCAGGCGGAGGCTTATACCCAGT
GAACGTCTACAGATACAGCCCCGGAGATAGCCACCTGCCCGCTGGCCTGTACTTATTCAACCCCATAACC
TGCCAATGGCAGCAGTTGAGGGCTGATTCCCCACGAGGCGAACACTCGCGTTCTGTCGGTGAGACCCTGC
TGGTTACCGTGGAGTTTTGGCGTTCAGCGTTTAAGTACGGTGACTTTGCGTATCAAGCGACCTCCGTGGA
TGTGGGGATCGTTGTTGCAGCGTTAGTCTCCCAACTGGATGCAGCTGTTGGGCCGGTGGCGATCGACTGG
TCACCCGACGAGCTTGCTCTCTCCGAATTCCTTGGTAGTGATCCCCTCGACGAGGCCATATATTGCACGA
TCACGCTGCCTAACGGCTCCCCTTCAGACACTGTTACCGCTGGCGCGCCATCAGCCGTTCTCCAGACTGC
TGCTCGACTCGCGCACTCGGGAACGATGCCCGTACGTTTTCCCACCACTGTGGCTTTGCAAAAACAGCGG
CTCCGAGAAATGCAGAGTATGCGTGCGCCTTTTTCTACGGAAAGAATCGCCGCCCCGCCACCAGCAATAA
TCAAGCGAGGCTCCAGCTCTTTTGGGCGCTATTCCGGAGCTCCAATCGACGTGGGTGTGCTTACTCGCAT
GGTGCAACGCGGGCGTGCCACGGCCGCTTCACTCCTGGGAACCCCTCCTGAAACTGATTATTTCTTGGGT
ATCCAAGCAGCCGCGCTGTGTGTCAACGTCACGGGCTTAGCACATTCTCTTATAGCGGATAGTGAGACAT
ATCCTGCGTCGACTCCTGCGCGCCCGTGTCCACAGCTTCCCGAGTTATTGCGCAACACCTATCTCCTGAA
AAACTACGACCCCCTGCGCAGCTCAGCCGTCTTAGTGCTGTGCGCAGATTTGCAGCGGGTAACCACTACT
TACGGCGCCTCTGGTTATCGGTGGGCATGTGCTGAGGTCGGGGCCTTTTGTCACGCTGTCTATGCTGTTG
CGGCACAGGAACGGGTCTCTGTGGGCGCTGTGTTGGGGTTTGATGCTCAGTACCAGCGCGACTACCTCGG
TTTAGCAGATAACCTCGTCCCGATCCTCAACATTCTTGTGGGTGTGGATCGGCCTCATGCACGGTGGAGG
AACTCGTTACTATGA
 Primer design

Protein Sequence:494 a.a.
>CDCE8392_1864|ThioFinder1444 Corynebacterium diphtheriae CDCE 8392
MDRHTADFWATTDNAATEYTQLILERKEHGMVFPVQGPFWNHQPYPAKIVPDAPRFQLHTHAMSPTDIAI
AQALEDSLIRTHLRAEVDCNSPTRTRSEAQSFQWSRNTASGGGLYPVNVYRYSPGDSHLPAGLYLFNPIT
CQWQQLRADSPRGEHSRSVGETLLVTVEFWRSAFKYGDFAYQATSVDVGIVVAALVSQLDAAVGPVAIDW
SPDELALSEFLGSDPLDEAIYCTITLPNGSPSDTVTAGAPSAVLQTAARLAHSGTMPVRFPTTVALQKQR
LREMQSMRAPFSTERIAAPPPAIIKRGSSSFGRYSGAPIDVGVLTRMVQRGRATAASLLGTPPETDYFLG
IQAAALCVNVTGLAHSLIADSETYPASTPARPCPQLPELLRNTYLLKNYDPLRSSAVLVLCADLQRVTTT
YGASGYRWACAEVGAFCHAVYAVAAQERVSVGAVLGFDAQYQRDYLGLADNLVPILNILVGVDRPHARWR
NSLL