Home 

Gene Symbol:  
CDCE8392_1863
Organism:  
Corynebacterium diphtheriae CDCE 8392
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1963740..1965290 [1], 1551 bp
Product Function:  
Uncharacterized conserved protein
Product Locus:  
 YP_005134397.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1551 bp
>CDCE8392_1863|ThioFinder1443 Corynebacterium diphtheriae CDCE 8392
ATGACTACGCGCGTCGCCTACCTGTACTGCCCGGCGCGCAGTTTCCCAGCGCACGCCCTGCCTCCGCGTC
ATGAGCAGTGGATAGCAGTCCCCTCCAAGGTGTGCAGGGTCTGCCTTAACGCATGGGTGGATCGCACGGA
AGAGGCTGCGGACTGGGTTAAGGCTGCTAGAGTACCCGGCTTCATCAGACGTTGGCTGTCTGAGCGTGTG
CACTACGTCGAGCGCCCCTTGGGAGGTTGGAGGCTAGCAGCTACTGATGCGCAGTGCCTCTCCAGTTCTA
CGGTATTTATTCCGCCAAGCCCGTGCTGTACTGAGCACCACGATTGTGCTGCTAACGCAGAGGTTTCCGA
TCTCACAGGGCCTGTGTTAGCACCGTGTGGGACGGGGCCGATCACGGAGATTCGCCGTCCTGGAATGGTG
GTTTCCCGTGGAACCATGCCTACTGTGAGGTCTCGACCAGCATTCCATTGGAGTGGTCAGGCGCCGACCA
TTGCTGAGAGCCGAAAGCTGGCTCTTTGTGAGGCCGTCGAGCGCGCATCCGCATGTGGGAATGAGGGAGC
GGGAGGCGTCGATACGCATATTCCCCACGTCCCTGCCACTGATTTTGGGGTGGACAACGAACGGTGGAAC
CGTTCTTACGATCACTGCCGCAATTGGACACGCGCTATTCGCTTGGGAGATGAAACCGCATGGGCAGTCC
CCACGGATATGGCGTTTTTCTGGTCTGACGCACAAGCTCGTTTTTGCTTCGATTCCTCCAGCGGCGCCGC
GGTGGGGCGCACATGGGAGGACGCGGTGATGTCTGGGTTAGTAGAGGTCATTGAACGTGACGCTGTCCTG
GCCGTATGGCATGGTTCCATGACCGTCCCAGAGATCGATGTTGACTCGATCAATGATCGCACTTACCAGG
CAATGCTGCGGCATCTTCGCAGGCAAGGGCTGGTTATCCGCGCGTTTTACTGCCCGCTGAGTGTAGGAGT
TCCTGCTGTTATTGCGGTATGCACGGATACTGAGCGCACTTTCCTCTGTGTTGGGGCAGCCGCCGCACCC
GATCCCTATGTCGCAGTACGCAAAGCTCTACGGGAGGTCATGGCGGATTATCCGCAGTCGCGTTTGCTTG
CTAGTACACGGTTGTCAGACGCTGCCGCAGTGCGTGCGGACGGTTCCGGGGCAGCTCATCGCCTCAGCGT
TGCTGCTTCCGAGCTTATCGACGCCGCCGCTTTCCTCCTCCTGCCCCGTAAAGAGCTGCTCCGTGTCTCC
GACATCCCGGGGTGCCCTCGCTTGTCTCTCGTTGAGCTAGTCGAGCGTCTCAAAGCACATGGCTTTTACG
GCTATGTTGTCGACTTCACCCAGAGTTATCACCAAATGGTGGGGCTTTCAGCTGTCAAGGTTATTGTCCC
TGGTCTCTTGCCCCTGGAATATATCGGACAGCTGACTAGGGCATTACATATGCCTAGGTTGAGGCAACAG
ATGACATGTTTTCGCGCTTTGGGCCTAGCCCCTCCCAGCTCACCTCCCCGTCTCAATCTTGTTCCGCACC
CGCTTCCTTAA
 Primer design

Protein Sequence:516 a.a.
>CDCE8392_1863|ThioFinder1443 Corynebacterium diphtheriae CDCE 8392
MTTRVAYLYCPARSFPAHALPPRHEQWIAVPSKVCRVCLNAWVDRTEEAADWVKAARVPGFIRRWLSERV
HYVERPLGGWRLAATDAQCLSSSTVFIPPSPCCTEHHDCAANAEVSDLTGPVLAPCGTGPITEIRRPGMV
VSRGTMPTVRSRPAFHWSGQAPTIAESRKLALCEAVERASACGNEGAGGVDTHIPHVPATDFGVDNERWN
RSYDHCRNWTRAIRLGDETAWAVPTDMAFFWSDAQARFCFDSSSGAAVGRTWEDAVMSGLVEVIERDAVL
AVWHGSMTVPEIDVDSINDRTYQAMLRHLRRQGLVIRAFYCPLSVGVPAVIAVCTDTERTFLCVGAAAAP
DPYVAVRKALREVMADYPQSRLLASTRLSDAAAVRADGSGAAHRLSVAASELIDAAAFLLLPRKELLRVS
DIPGCPRLSLVELVERLKAHGFYGYVVDFTQSYHQMVGLSAVKVIVPGLLPLEYIGQLTRALHMPRLRQQ
MTCFRALGLAPPSSPPRLNLVPHPLP