Home 

Gene Symbol:  
CDHC03_1858
Organism:  
Corynebacterium diphtheriae HC03
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1989710..1990723 [1], 1014 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_005138903.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1014 bp
>CDHC03_1858|ThioFinder1467 Corynebacterium diphtheriae HC03
ATGCGTACAACCGACCCCTGGCTCGCTTTTCATATTTTTTATGGAGAAGACCCTTCTCTCTTGCTCCGCG
ACTGCCTGCTGCCTTTTGCTCATACATGCGTTGCAGAAGGACTGGTAAAACGATTTTTCCATATGAATTA
CTGGTTGGAGGGCGCACACGTCCGCTTAAGGCTAGAGCTTTGCAATCCGGCAGATCGCGAGCGCGTCGTA
TGCGCAGCGCATCAGGCTATCCAACCGTGGATTGACTCCCATCCTTCCAGCGCGCCCCAGCTGTCCCTGC
GCAATCCCGAAGGTTATCGGCGCCTCTTTGAACACGAGTACCCCATGTCCAGGTTCTCCGACTATATCGA
TCAGGATGGTCTGCCCCGTCTACAGCCAGATAACTGCATCCGAGAACGCTACTACGAGCGTGAATATGAC
CGCTACGGCGGACAGATAGGGATGTCGCTTAGCCAAGATGTTTTTCAAACCTCGACGTTGTTTGTCGAGA
AGCTTTTACACTCTGGCGTTTTAGAAGCACGTACCTCACGACTAGCCGCGGCTGCGCTAGGAATGATCTG
CACTGCGCATACAGTTTTGGCTTCCGACGCAGCCATAGAACGTTTTTGGGAAAGCTATCACGCAGGTTGG
ACCTCGTCTTTTTCTATGCCCACCAGCTACACCTCGCCCACGGCACAGCACAAAATCGCCACCGAGGCTC
AGGCGCTCTCACGTGCAGCCACGCCATTTCGTGCGGCCTTGCGCCACGCCCCAGACGGTTCAAGTCTTCC
CGAACCCTATGCCACTTTTACTCAACGCATGACCTCTCTCATGCGCAAACTCCACGATGCATATGATTCC
CGAGAGCTTGATTTTGGTGATTCTGCGGCAGAGGCTGGCCACACGTGGAAAGAGAACTCCATTTTTCTTC
TGCGCTCCTATGTCCATATGACCAACAACAGAATGTCCGTCAATATCTCGGATGAGGCCTATTTAGCTTA
TTTACTGCACGCGTTATATCGGGAGGCGCTATGA
 Primer design

Protein Sequence:337 a.a.
>CDHC03_1858|ThioFinder1467 Corynebacterium diphtheriae HC03
MRTTDPWLAFHIFYGEDPSLLLRDCLLPFAHTCVAEGLVKRFFHMNYWLEGAHVRLRLELCNPADRERVV
CAAHQAIQPWIDSHPSSAPQLSLRNPEGYRRLFEHEYPMSRFSDYIDQDGLPRLQPDNCIRERYYEREYD
RYGGQIGMSLSQDVFQTSTLFVEKLLHSGVLEARTSRLAAAALGMICTAHTVLASDAAIERFWESYHAGW
TSSFSMPTSYTSPTAQHKIATEAQALSRAATPFRAALRHAPDGSSLPEPYATFTQRMTSLMRKLHDAYDS
RELDFGDSAAEAGHTWKENSIFLLRSYVHMTNNRMSVNISDEAYLAYLLHALYREAL