Home 

Gene Symbol:  
CDHC03_1857
Organism:  
Corynebacterium diphtheriae HC03
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1987677..1989710 [1], 2034 bp
Product Function:  
lantibiotic dehydratase domain-containing protein
Product Locus:  
 YP_005138902.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2034 bp
>CDHC03_1857|ThioFinder1466 Corynebacterium diphtheriae HC03
GTGATCCGCAGCGCCACCCGGTCAGTACCGTTTTCCGCCCTGTGCGCAATCGCGCCGTCTCAGTTGTCCC
ACGCCAGCCTACACTCGGATGAGACTCTTGCCCCAACATCTGTGCACACTATTGCGCGTTGGAACGTCTA
CGCCATGGCTCAGATTTTCTCTGCTATGAAGAAAGACTTTGGTTTTATTGCCACACTTCCGGTTCTGGTT
AATCCTGACGCGTTATCAGAGCATGGCCACTGCGTACTGCCTCGGTGTTCTGTCGAATATCTAGGGCACG
TCGGCGACCGGGACTTGGCCGTTTACCGGGAGGAACGCCGAGTGGTCGATTCCAATGGACTATTTGGAAA
GGTCATGGCCTTAGCCACAAGTGCTCCCCAAAACCACGAATACACGTGTGAGCAGCTGGCCGCAGAGCTC
TCGGCGCGTACAGGTTTAAGCAAGGCACAAACAAAGTGCATTGTTCTCGATGCCATCCGAATTTCGGCCT
TAGTTGTTCCCACTCTCGATTTATCCCCGTCCACAGCGGTATCTGAACAGCCGATAGTTACGCGCTTGGC
ACGTGGGTCGGACAAGGCCGTATCTGCTGCGCGTCTCATTGCCCGCATCACGGAGGAATGCAACGCGGTG
GCGTCGATAAGCGACTTTGACCGCAGGCACACTCAGATCCTAGATCTCGCGCACCACCTGGATAGCCTCC
GGCGACTCGTCGATCCCAGCATGCCGGTGTTCCATACCCATGTGTATGAGGATGGGGTCGGGAAAGAATC
GACGATTCCCTCCTCCATCGTGGACTCGTGCACAGCCCTTGACTGGGAAGCTCTCGCAGACCTAGTCGAT
CTGCTTGATGTGCGGCAGGCAGAACGCGCGTTGTTTGAGGAGTTTGTGTCCGCAAAATTCCCCCGTGGGG
AAATCTGCCACGATGTTCCGGCGGTGGTCAATAGTTTTGTCTCCGAGGTCCTCACGCCGCTGCGGCAGGT
TGATATTGAGGCAGTTGATGAAAATGACCTGAAGTCCACTGCATCGTTGCCACTGGGTAAGGCATGGGAA
TGGATTCGGGCGCGGCGCCGCTTCCTGGCACACGTAACCGAGTTAAGAAACAACGCCGCTGGTCCCGTGG
ATATACGGAATCTCCTCACCAACTATCGTCCACTTGTGCAGTCTCGTAGGTATCCGCTTCGATCTTTAAA
CGCATACGTTCAGCAAGGCGACGAGGCCAAAGTCGTGATTAACCGGACGCTCGGCGGCCCAGGCTTCCCG
TGGTCTCGGTTCGCGCATGCGATACCGGATTCCGCAGCACGCGCATGGTCCGAATTATCGGATTATGCGT
CTGACGCTGGCGTGACGCTTGTCGAGTTGACAGCCGGAAAAGTGGTCTCCAACCTCAACGCGCATCCGGC
CACCTACCCAACCACTCTCCTCATCCCAGGGCATCCTCGAAAAACCACACGGTCGTCTGATATTCGACTC
GCAGACACGCAGTTGGCCTACTGCGCATCCAGCGGACGCTTGCAGCTTTTCGACGGCCACGGCACCGAAC
TCCTCCCCGCATACATGGGATACATCACTGACCGGGGACTGCCATTATCTACGCAAGCCCTCATGCTCCT
AGCGCCACCCATGCATTGTTCCTTGGACTTTTTCCCGCGCACGAGTTCAGAGATAGTTCATCAGGCTCGT
CTACTCCTAGGAGATGTTGTTCTTGCGCGAGAAAGCTGGATTTTTCCCACCTCAAGCACCTCTATGGATA
TTCCGTGTCTCCTAGAAGAGGCACTGGTGTGGTGGCGCAGCATTGCCCGACATCACGACCTACCCGAGTG
CGGAGTTCTGCGAACATTCGATGCCCACGGCGTTGTGGGTAAAGGACAGTTTTATAACTCCCAAATCATG
GGAACGATCACCAACCTCATACGCGCATTGCGCAACGCTCACTACGGGTTTGTGATTGAGGAATTCTTTC
CCCACGTCGGCGCGTCCGGTGTAGCACAGGAATACATAGTAACAGGAACGCGCTCTTTGAAGGAGGGTAT
CTAA
 Primer design

Protein Sequence:677 a.a.
>CDHC03_1857|ThioFinder1466 Corynebacterium diphtheriae HC03
MIRSATRSVPFSALCAIAPSQLSHASLHSDETLAPTSVHTIARWNVYAMAQIFSAMKKDFGFIATLPVLV
NPDALSEHGHCVLPRCSVEYLGHVGDRDLAVYREERRVVDSNGLFGKVMALATSAPQNHEYTCEQLAAEL
SARTGLSKAQTKCIVLDAIRISALVVPTLDLSPSTAVSEQPIVTRLARGSDKAVSAARLIARITEECNAV
ASISDFDRRHTQILDLAHHLDSLRRLVDPSMPVFHTHVYEDGVGKESTIPSSIVDSCTALDWEALADLVD
LLDVRQAERALFEEFVSAKFPRGEICHDVPAVVNSFVSEVLTPLRQVDIEAVDENDLKSTASLPLGKAWE
WIRARRRFLAHVTELRNNAAGPVDIRNLLTNYRPLVQSRRYPLRSLNAYVQQGDEAKVVINRTLGGPGFP
WSRFAHAIPDSAARAWSELSDYASDAGVTLVELTAGKVVSNLNAHPATYPTTLLIPGHPRKTTRSSDIRL
ADTQLAYCASSGRLQLFDGHGTELLPAYMGYITDRGLPLSTQALMLLAPPMHCSLDFFPRTSSEIVHQAR
LLLGDVVLARESWIFPTSSTSMDIPCLLEEALVWWRSIARHHDLPECGVLRTFDAHGVVGKGQFYNSQIM
GTITNLIRALRNAHYGFVIEEFFPHVGASGVAQEYIVTGTRSLKEGI