Home 

Gene Symbol:  
CDHC03_1855
Organism:  
Corynebacterium diphtheriae HC03
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1985630..1987114 [1], 1485 bp
Product Function:  
Nitroreductase
Product Locus:  
 YP_005138900.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1485 bp
>CDHC03_1855|ThioFinder1464 Corynebacterium diphtheriae HC03
ATGGATCGCCATACTGCAGATTTTTGGGCCACAACGGATAACGCTGCGACCGAATACACGCAGCTCATTC
TGGAGCGCAAAGAACATGGCATGGTCTTCCCTGCTCAAGGTCCCTTTTGGAACCATCAACCCTACCCCGC
AAAAATTGTTCCAGACGCCCCTCGTTTCCAGCTTCATGCACACGCCATGTCCCCCACGGACATCGCTATT
GCGCAAGCGCTGGAGGATTCTCTGATCAGAACTCATCTGCGCGCAGAAGTCGACTGCAACTCGCCGACAA
AGACCCGATCTGAGGCGCAATCTTTTCAGTGGTCTCGGAATACAGCCTCAGGCGGAGGCTTATACCCAGT
GAACGTCTACAGATACAGCCCCGGAGATAGCCACCTGCCCGCTGGCCTGTACTTATTCAACCCCATAACC
TGCCAATGGCAGCAGTTGAGGGCTGATTCCCCACGAGGCGAACACTCGCGTTCTGCCGGTGAGACCCTGC
TGGTTACCGTGGAGTTTTGGCGTTCAGCGTTTAAGTACGGTGACTTTGCGTATCAAGCGACCTCCGTGGA
TGTGGGGATCGTTGTCGCGGCGTTAGTCTCCCAACTGGATGCAGCTGTTGGGCCGGTGGCGATCGACTGG
TCACCCGACGAGCTTGCTCTCTCCGAATTCCTTGGTAGTGATCCCCTCGACGAGGCCATATATTGCACGA
TCACGCTGCCTAACGGCTCCCCTTCAGACACTGTTACCGCTGGCGTGCCATCAGCCGTTCTCCAGACTGC
TGCTCGACTCGCGCACTCGGGAACGATGCCCGTACGTTTTCCTACCACTGTGGCTTTGCAAAAACAGCGG
CTCCGAGAAATGCAGAGTATGCGTGCGCCTTTTTCTACGGAAAGAATCGCCGCCCCGCCACCAGCAATAA
TCAAGCGAGGGTCCAGCTCTTTTGGGCGCTATTCCGGAGCTCCAATCGACGTGGGTGTGCTTACTCGCAT
GGTGCAACGCGGGCGTGCCACGGCCGCTTCACTCCTGGGAACCCCTCCTGAAACTGATTATTTCTTGGGT
ATCCAAGCAGCCGCGCTGTGTGTCAACGTCACGGGCTTAGCACATTCTCTTATAGCGGATAGTGAGACAT
ATCCTGCGTCGGCTCCTGCGCGCCCGTGTCCACAGCTTCCCGAGTTATTGCGCAACACCTATCTCCTGAA
AAACTACGACCCCCTGCGCAGCTCAGCCGTCTTAGTGCTGTGCGCAGATTTGCAGCGGGTAACCACTACT
TACGGTGCCTCTGGTTATCGGTGGGCATGTGCTGAGGTCGGGGCCTTTTGTCACGCTGTCTATGCAGTTG
CGGCACAGGAACGGGTCTCTGTGGGCGCTGTGTTGGGGTTTGATGCTCAGTACCAGCGCGACTACCTCGG
TTTAGCAGATAACCTCGTCCCGATCCTCAACATTCTTGTGGGTGTGGATCGGCCTCATGCACGGTGGAGG
AACTCGTTACTATGA
 Primer design

Protein Sequence:494 a.a.
>CDHC03_1855|ThioFinder1464 Corynebacterium diphtheriae HC03
MDRHTADFWATTDNAATEYTQLILERKEHGMVFPAQGPFWNHQPYPAKIVPDAPRFQLHAHAMSPTDIAI
AQALEDSLIRTHLRAEVDCNSPTKTRSEAQSFQWSRNTASGGGLYPVNVYRYSPGDSHLPAGLYLFNPIT
CQWQQLRADSPRGEHSRSAGETLLVTVEFWRSAFKYGDFAYQATSVDVGIVVAALVSQLDAAVGPVAIDW
SPDELALSEFLGSDPLDEAIYCTITLPNGSPSDTVTAGVPSAVLQTAARLAHSGTMPVRFPTTVALQKQR
LREMQSMRAPFSTERIAAPPPAIIKRGSSSFGRYSGAPIDVGVLTRMVQRGRATAASLLGTPPETDYFLG
IQAAALCVNVTGLAHSLIADSETYPASAPARPCPQLPELLRNTYLLKNYDPLRSSAVLVLCADLQRVTTT
YGASGYRWACAEVGAFCHAVYAVAAQERVSVGAVLGFDAQYQRDYLGLADNLVPILNILVGVDRPHARWR
NSLL