Home 

Gene Symbol:  
CDHC03_1854
Organism:  
Corynebacterium diphtheriae HC03
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1984044..1985594 [1], 1551 bp
Product Function:  
Uncharacterized conserved protein
Product Locus:  
 YP_005138899.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1551 bp
>CDHC03_1854|ThioFinder1463 Corynebacterium diphtheriae HC03
ATGACTACGCGCGTCGCCTACCTGTACTGCCCGGCGCGCAGTTTCCCAGCGCACGCCCTGCCTCCGCGTC
ATGAGCAGTGGATAGCAGTCCCCTCCAAGGTGTGCAGGGTCTGCCTTAACGCATGGGTGGATCGCACGGA
AGAGGCTGCGGACTGGGTTAAGGCTGCTAGAGTACCCGGCTTCATCAGACGTTGGCTGTCTGAGCGTGTG
CACTACGTCGAGCGCCCCTTGGGAGGTTGGAGACTAGCAGCTACTGATGCGCAGTGCCTCTCCAGTTCTA
CGGTATTTATTCCGCCAAGCCCGTGCTGCACTGAGCACCACGATTGTGCTGCTAACGCAGAGGTTTCCGA
TCTCACAGGGCCTGTGTTAGCACCGTGTGGGACGGGGCCGATCACGGAGATTCGCCGTCCTGGAATGGTG
GTTTCCCGTGGAACCATGCCTACTGTGGGGTCTCGACCAGCATTCCATTGGAGTGGTCAGGCGCCGACCA
TTGCTGAGAGCCGAAAGCTGGCTCTTTGTGAGGCCGTCGAGCGCGCATCCGCGTGTGGGAATGAGGGAGC
GGGAGGCGTCGATACGCATATTCCCCACGTCCCTGTCACTGATTTTGGGGTGGACAACGAACGGTGGAAC
CGTTCTTACGATCACTGCCGCAATTGGACACGCGCTATTCGTCTGGGAGATGAAACTGCATGGGCAGTCC
CCACGGATATGGCGTTTTTCTGGTCTGACGCACAAGCTCGTTTTTGCTTCGATTCCTCCAGCGGCGCCGC
GGTGGGGCGCACATGGGAGGACGCGGTGATGTCTGGGTTAGTAGAGGTCATTGAACGTGACGCTGTCCTG
GCCGTATGGCATGGTTCCATGACCGTCCCAGAGATCGATGTTGACTCGATCAATGATCGCACTTACCAGG
CAATGCTGCGGCATCTTCGCAGGCAAGGGCTGGTTATCCGCGCGTTTTACTGCCCGCTGAGTGTAGGAGT
TCCTGCTGTTATTGCGGTATGCATGGATACTGAGCGCACTTTCCTCTGTGTTGGGGCAGCTGCCGCACCC
GATCCCTATGTCGCAGTACGCAAAGCTCTACGGGAGGTCATGGCGGATTATCCGCAGTCGCGTTTGCTTG
CTAGTACACGGTTGTCAGACGCTGCCGCAGTGCGTGCGGACGGTTCCGGGGCAGCTCATCGCCTCAGCGT
TGCCGCTTCCGAGCTTATCGACGCCGCCGCTTTCCTCCTCCTGCCCCGTAAAGAGCTGCTCCGTGTCTCC
GACATCCCGGGGTGCCCTCGATTGTCTCTCGTTGAGCTAGTCGAGCGTCTCAAAGCACATGGCTTTTACG
GCTATGTTGTCGACTTCACCCAGAGTTATCACCAAATGGTGGGGCTTTCAGCTGTCAAGGTTATTGTCCC
TGGTCTCTTGCCGCTGGAATATATCGGACAGCTGACTAGGGCATTGCATATGCCTAGGTTGAGGCAACAG
ATGACACGTTTTCGCGCTTTGGGCCTAGCCCCTCCCAGCTCACCTCCCCGTCTCAATCTTGTTCCGCACC
CGCTTCCCTAA
 Primer design

Protein Sequence:516 a.a.
>CDHC03_1854|ThioFinder1463 Corynebacterium diphtheriae HC03
MTTRVAYLYCPARSFPAHALPPRHEQWIAVPSKVCRVCLNAWVDRTEEAADWVKAARVPGFIRRWLSERV
HYVERPLGGWRLAATDAQCLSSSTVFIPPSPCCTEHHDCAANAEVSDLTGPVLAPCGTGPITEIRRPGMV
VSRGTMPTVGSRPAFHWSGQAPTIAESRKLALCEAVERASACGNEGAGGVDTHIPHVPVTDFGVDNERWN
RSYDHCRNWTRAIRLGDETAWAVPTDMAFFWSDAQARFCFDSSSGAAVGRTWEDAVMSGLVEVIERDAVL
AVWHGSMTVPEIDVDSINDRTYQAMLRHLRRQGLVIRAFYCPLSVGVPAVIAVCMDTERTFLCVGAAAAP
DPYVAVRKALREVMADYPQSRLLASTRLSDAAAVRADGSGAAHRLSVAASELIDAAAFLLLPRKELLRVS
DIPGCPRLSLVELVERLKAHGFYGYVVDFTQSYHQMVGLSAVKVIVPGLLPLEYIGQLTRALHMPRLRQQ
MTRFRALGLAPPSSPPRLNLVPHPLP