Home 

Gene Symbol:  
CDPW8_1947
Organism:  
Corynebacterium diphtheriae PW8
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2065872..2066885 [1], 1014 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_005143498.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1014 bp
>CDPW8_1947|ThioFinder1486 Corynebacterium diphtheriae PW8
ATGCGTACAACCGACCCCTGGCTCGCTTTTCATATTTTTTATGGAGAAGACCCTTCTCTCTTGCTCCGCG
ACTGCCTGCTGCCTTTTGCTCATACATGCGTTGCAGAAGGACTGGTAAAACGATTTTTCCATATGAATTA
CTGGTTGGAGGGCGCACACGTCCGCTTAAGGCTAGAGCTTTGCAATCCGGCAGATCGCGAGCGCGTCGTA
TGCGCAGCGCATCAGGCTATCCAACCGTGGATTGACTCCCATCCCTCCAGCGCGCCCCAGCTGTCCCTGC
GCAATCCCGAAGGTTATCGGCGCCTCTTTGAACACGAGTACCCCATGTCCAGGTTCTCCGACTATATCGA
TCAGGATGGTCTGCCCCGTCTACAGCCAGATAACTGCATCCGAGAACGCTACTACGAGCGTGAATATGAC
CGCTACGGCGGACGGATAGGGATGTCGCTTAGCCAAGATGTTTTTCAAACCTCGACGTTGTTCGTCGAGA
AGCTTTTACACTCTGGCGTTTTAGAAGCACGTACCTCACGACTAGCCGCAGCTGCGCTAGGAATGATCTG
CACCGCGCATACAGTTTTGGATTCCGACGCAGCCATAGGACGCTTTTGGGAAAGCTATCACGCAGGTTGG
ACCTCGTCTTTTTCCATGCCCACCAGCTACACCTCGCCCACGGCACAGCACAAAATCGCCACCGAGGCTC
AGGCGCTCTCACGTGCAGCCACGCCATTTCGTGCGGCCTTGCGCCACGCCCCAGACGGTTCAAGTCTTCC
CGAACCCTATGCCACTTTTACTCAACGCATGACCTCTCTCATGCGCAAACTCCACGATGCATATGATTCC
CGAGAGCTCGATTTTGGTGATTCTGCCGCAGAGGCCGGCCACACGTGGAAAGAAAATTCCATTTTTCTTC
TGCGCTCCTATGTCCATATGACCAACAACAGAATGTCCGTCAATATCTCGGATGAGGCCTATTTAGCTTA
TTTACTGCACGCGTTATATCGGGAGGCGCTATGA
 Primer design

Protein Sequence:337 a.a.
>CDPW8_1947|ThioFinder1486 Corynebacterium diphtheriae PW8
MRTTDPWLAFHIFYGEDPSLLLRDCLLPFAHTCVAEGLVKRFFHMNYWLEGAHVRLRLELCNPADRERVV
CAAHQAIQPWIDSHPSSAPQLSLRNPEGYRRLFEHEYPMSRFSDYIDQDGLPRLQPDNCIRERYYEREYD
RYGGRIGMSLSQDVFQTSTLFVEKLLHSGVLEARTSRLAAAALGMICTAHTVLDSDAAIGRFWESYHAGW
TSSFSMPTSYTSPTAQHKIATEAQALSRAATPFRAALRHAPDGSSLPEPYATFTQRMTSLMRKLHDAYDS
RELDFGDSAAEAGHTWKENSIFLLRSYVHMTNNRMSVNISDEAYLAYLLHALYREAL