Home 

Gene Symbol:  
CDPW8_1944
Organism:  
Corynebacterium diphtheriae PW8
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2060205..2061755 [1], 1551 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_005143495.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1551 bp
>CDPW8_1944|ThioFinder1483 Corynebacterium diphtheriae PW8
ATGACTACGCGCGTCGCCTACCTGTACTGCCCGGCGCGCAGTTTCCCAGCGCACGCCCTGCCTCCGCGTC
ATGAGCAGTGGATAGCAGTCCCCTCCAAGGTGTGCAGGGTCTGCCTTAACGCATGGGTGGATCGCACGGA
AGAGGCTGCGGACTGGGTTAAGGCTGCTAGAGTACCCGGCTTCATCAGACGTTGGCTGTCTGAGCGTGTG
CACTACGTCGAGCGCCCCTTGGGAGGTTGGAGACTAGCAGGTACTGATGCGCAGTGCCTCTCCAGTTCTA
CGGTATTTATTCCGCCAAGCCCGTGCTGCACTGAGCACCACGATTGTGCTGCTAACGCAGAGGTTTCCGA
TCTCACAGGGCCTGTGTTAGCACCGTGTGGGACGGGGCCGATCACGGAGATTCGCCGTCCTGGAATGGTG
GTTTCCCGTGGAACCATGCCTACTGTGGGGTCTCGACCAGCATTCCATTGGAGTGGTCAGGCGCCGACCA
TTGCTGAGAGCCGAAAGCTGGCTCTTTGTGAGGCCGTCGAGCGCGCATCCGCGTGTGGGAATGAGGGAGC
GGGAGGCGTCGATACGCATATTCCCCACGTCCCTGTCACTGATTTTGGGGTGGACAACGAACGGTGGAAC
CGTTCTTACGATCACTGCCGCAATTGGACACGCGCTATTCGTCTGGGAGATGAAACTGCATGGGCAGTCC
CCACGGATATGGCGTTTTTCTGGTCTGACGCACAAGCTCGTTTTTGCTTCGATTCCTCCAGCGGCGCCGC
GGTGGGGCGCACATGGGAGGACGCGGTGATGTCTGGGTTAGTAGAGGTCATTGAACGTGACGCTGTCCTG
GCCGTATGGCATGGTTCCATGACCGTCCCAGAGATCGATGTTGACTCGATCAATGATCGCACTTACCAGG
CAATGCTGCGGCATCTTCGCAGGCAAGGGCTGGTTATCCGCGCGTTTTACTGCCCGCTGAGTGTAGGAGT
TCCTGCTGTTATTGCGGTATGCATGGATACTGAGCGCACTTTCCTCTGTGTTGGGGCAGCTGCCGCACCC
GATCCCTATGTCGCAGTACGCAAAGCTCTACGGGAGGTCATGGCGGATTATCCGCAGTCGCGTTTGCTTG
CTAGTACACGGTTGTCAGACGCTGCCGCAGTGCGTGCGGACGGTTCCGGGGCAGCTCATCGCCTCAGCGT
TGCCGCTTCCGAGCTTATCGACGCCGCCGCTTTCCTCCTCCTGCCCCGTAAAGAGCTGCTCCGTGTCTCC
GACATCCCGGGGTGCCCTCGCTTGTCTCTCGTTGAGCTAGTCGAGCGTCTCAAAGCACATGGCTTTTACG
GCTATGTTGTCGACTTCACCCAGAGTTATCACCGAATGGTGGGGCTTTCAGCTGTCAAGGTTATTGTCCC
TGGTCTCTTGCCCCTGGAATATATCGGACAGCTGACTAGGGCATTACATATGCCTAGGTTGAGGCAACAG
ATGACATGTTTTCGCGCTTTGGGCCTAGCCCCTCCCAGCTCACCTCCCCGTCTCAATCTTGTTCCGCACC
CGCTTCCCTAA
 Primer design

Protein Sequence:516 a.a.
>CDPW8_1944|ThioFinder1483 Corynebacterium diphtheriae PW8
MTTRVAYLYCPARSFPAHALPPRHEQWIAVPSKVCRVCLNAWVDRTEEAADWVKAARVPGFIRRWLSERV
HYVERPLGGWRLAGTDAQCLSSSTVFIPPSPCCTEHHDCAANAEVSDLTGPVLAPCGTGPITEIRRPGMV
VSRGTMPTVGSRPAFHWSGQAPTIAESRKLALCEAVERASACGNEGAGGVDTHIPHVPVTDFGVDNERWN
RSYDHCRNWTRAIRLGDETAWAVPTDMAFFWSDAQARFCFDSSSGAAVGRTWEDAVMSGLVEVIERDAVL
AVWHGSMTVPEIDVDSINDRTYQAMLRHLRRQGLVIRAFYCPLSVGVPAVIAVCMDTERTFLCVGAAAAP
DPYVAVRKALREVMADYPQSRLLASTRLSDAAAVRADGSGAAHRLSVAASELIDAAAFLLLPRKELLRVS
DIPGCPRLSLVELVERLKAHGFYGYVVDFTQSYHRMVGLSAVKVIVPGLLPLEYIGQLTRALHMPRLRQQ
MTCFRALGLAPPSSPPRLNLVPHPLP