Home 

Gene Symbol:  
CD31A_1975
Organism:  
Corynebacterium diphtheriae 31A
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2054188..2055201 [1], 1014 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_005158669.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1014 bp
>CD31A_1975|ThioFinder1508 Corynebacterium diphtheriae 31A
ATGCGTACAACCGACCCCTGGCTCGCTTTTCATATTTTTTATGGAGAAGACCCTTCTCTCTTGCTCCGCG
ACTGCCTGCTGCCTTTTGCTCATACATGCGTTGCAGAAGGACTGGTAAAACGATTTTTCCATATGAATTA
CTGGTTGGAGGGCGCACACGTCCGCTTAAGGCTAGAGCTTTGCAATCCGGCAGATCGCGAGCGCGTCGTA
TGCGCAGCGCATCAGGCTATCCAACCGTGGATTGACTCCCATCCTTCCAGCGCGCCCCAGCTGTCCCTGC
GCAATCCCGAAGGTTATCGGCGCCTCTTTGAACACGAGTACCCCATGTCCAGGTTCTCCGACTATATCGA
TCAGGATGGTCTGCCCCGTCTACAGCCAGATAACTGCATCCGAGAACGCTACTACGAGCGTGAATATGAC
CGCTACGGCGGACAGATAGGGATGTCGCTTAGCCAAGATGTTTTTCAAACCTCGACGTTGTTCGTCGAGA
AGCTTTTACACGCTGGCGTTTTAGAAGCACGTACCTCACGACTAGCCGCGGCTGCGCTAGGAATGATCTG
CACTGCGCATACAGTTTTGGCTTCCGACGCAGCCATAGGACGTTTTTGGGAAAGCTATCACGCAGGCTGG
ACCTCGTCTTTTTCTATGCCCACCAGCTACACCTCGCCCACGGCACAGCACAAAATTGCCACCGAGGCTC
AGGCGCTCTCACGCGCAGCCACGCCATTTCGTACGGCCTTGCGCCACGCCCCAGACGGTTCAAATCTTCC
CGAACCCTATGCCACTTTTACTCAACGCATGACCTCTCTCGTGGGCAAACTCCACGATGCATATGATTCC
CGAGAGCTTGATTTTGGTGATTCTGCGGCAGAGGCTGGCCACACGTGGAAAGAGAACTCCATTTTTCTTC
TGCGCTCCTATGTCCATATGACCAACAACAGAATGTCCGTCAATATCTCGGATGAGGCCTATTTAGCTTA
TTTACTGCACACGCTATATCGGGAGGCGCTATGA
 Primer design

Protein Sequence:337 a.a.
>CD31A_1975|ThioFinder1508 Corynebacterium diphtheriae 31A
MRTTDPWLAFHIFYGEDPSLLLRDCLLPFAHTCVAEGLVKRFFHMNYWLEGAHVRLRLELCNPADRERVV
CAAHQAIQPWIDSHPSSAPQLSLRNPEGYRRLFEHEYPMSRFSDYIDQDGLPRLQPDNCIRERYYEREYD
RYGGQIGMSLSQDVFQTSTLFVEKLLHAGVLEARTSRLAAAALGMICTAHTVLASDAAIGRFWESYHAGW
TSSFSMPTSYTSPTAQHKIATEAQALSRAATPFRTALRHAPDGSNLPEPYATFTQRMTSLVGKLHDAYDS
RELDFGDSAAEAGHTWKENSIFLLRSYVHMTNNRMSVNISDEAYLAYLLHTLYREAL