Home 

Gene Symbol:  
CD31A_1973
Organism:  
Corynebacterium diphtheriae 31A
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2050107..2051591 [1], 1485 bp
Product Function:  
Nitroreductase
Product Locus:  
 YP_005158667.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1485 bp
>CD31A_1973|ThioFinder1506 Corynebacterium diphtheriae 31A
ATGGATCGCCATACTGCAGATTTTTGGGCCACAACGGATAACGCTGCGACCGAATACACGCAGCTCATTC
TGGAGCGCAAAGAACATGGCATGGTCTTCCCTGCTCAAGGTCCCTTTTGGAACCATCAACCCTATCCCGC
AAAAATTGTTCCAGACGCCCCTCGTTTCCAGCTTCATGCACACGCCATGTCCCCCACGGACATCGCTATT
GCGCAAGCGCTGGAGGATTCTCTGATCAGAACTCATCTGCGCGCAGAAGTCGACTGCAACTCGCCGACAA
GGACCCGATCTGAGGCGCAATCTTTTCAGTGGTCTCGGAATACAGCCTCAGGCGGAGGCTTATACCCAGT
GAACGTCTACAGATACAGCCCCGGAGATAGCCACCTGCCCGCTGGCCTGTATTTATTCAACCCCATAACC
TGCCAATGGCAGCAGTTGAGGGCTGATTCCCCACGAGGCGAACACTCGCGTTCTGCCGGTGAGACCCTGC
TGGTTACCGTGGAGTTTTGGCGTTCAGCGTTTAAGTACGGTGACTTTGCGTATCAAGCGACCTCCGTGGA
TGTGGGGATCGTTGTCGCGGCGTTAGTCTCCCAACTGGATGCAGCTGTTGGGCCGGTGGCGATCGACTGG
TCACCCGACGAGCTTGCTCTCTCCGAATTCCTTGGTAGTGATCCCCTCGACGAGGCCATATATTGCACGA
TCACGCTGCCTAACGGCTCCCCTTCAGACACTGTTACCGCTGGCGTGCCATCAGCCGTTCTCCAGACTGC
TGCTCGACTCGCGCACTCGGGAACGATGCCCGTACGTTTTCCTACCACTGTGGCTTTGCAAAAACAGCGG
CTCCGAGAAATGCAGAGTATGCGGGCGCCTTTTTCTACGGAAAGAATCGCCGCCCCGCCACCAGTAATAA
TCAAGCGAGGCTCCAGCTCTTTTGGGCGCTATTCCGGAGCTCCAATCGACGTGGGTGTGCTTACTCGCAT
GGTGCAACGCGGGCGTGCCACGGCCGCTTCACTCCTGGGAACCCCTCCTGAAACTGATTATTTCTTGGGT
ATCCAAGCAGCCGCGCTGTGTGTCAACGTCACGGGCTTAGCACATTCTCTTATAGCGGATAGTGAGACAT
ATCCTGCGTCGGCTCCTGCGCGCCCGTGTCCACAGCTTCCCGAGTTATTGCGCAACACCTATCTCCTGAA
AAACTACGACCCCCTGCGCAGCTCAGCCGTCTTAGTGCTGTGCGCAGATTTGCAGCGGGTAACCACTACT
TACGGTGCCTCTGGTTATCGGTGGGCATGTGCTGAGGTCGGGGCCTTTTGTCACGCTGTCTATGCAGTTG
CGGCACAGGAACGGGTCTCTGTGGGCGCTGTGTTGGGGTTTGATGCTCAGTATCAGCGCGACTACCTCGG
TTTAGCAGATAACCTCGTCCCGATCCTCAACATTCTTGTGGGTGTGGATCGGCCTCATGCTCGGTGGAGG
AACTCGTTACTATGA
 Primer design

Protein Sequence:494 a.a.
>CD31A_1973|ThioFinder1506 Corynebacterium diphtheriae 31A
MDRHTADFWATTDNAATEYTQLILERKEHGMVFPAQGPFWNHQPYPAKIVPDAPRFQLHAHAMSPTDIAI
AQALEDSLIRTHLRAEVDCNSPTRTRSEAQSFQWSRNTASGGGLYPVNVYRYSPGDSHLPAGLYLFNPIT
CQWQQLRADSPRGEHSRSAGETLLVTVEFWRSAFKYGDFAYQATSVDVGIVVAALVSQLDAAVGPVAIDW
SPDELALSEFLGSDPLDEAIYCTITLPNGSPSDTVTAGVPSAVLQTAARLAHSGTMPVRFPTTVALQKQR
LREMQSMRAPFSTERIAAPPPVIIKRGSSSFGRYSGAPIDVGVLTRMVQRGRATAASLLGTPPETDYFLG
IQAAALCVNVTGLAHSLIADSETYPASAPARPCPQLPELLRNTYLLKNYDPLRSSAVLVLCADLQRVTTT
YGASGYRWACAEVGAFCHAVYAVAAQERVSVGAVLGFDAQYQRDYLGLADNLVPILNILVGVDRPHARWR
NSLL