Home 

Gene Symbol:  
CD31A_1972
Organism:  
Corynebacterium diphtheriae 31A
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2048521..2050071 [1], 1551 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_005158666.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1551 bp
>CD31A_1972|ThioFinder1505 Corynebacterium diphtheriae 31A
ATGACTACGCGCGTCGCCTACCTGTACTGCCCGGCGCGCAGTTTCCCAGCGCACGCCCTGCCTCCGCGTC
ATGAGCAGTGGATAGCAGTCCCCTCCAAGGTGTGCAGGGTCTGCCTTAACGCATGGGTGGATCGCACGGA
AGAGGCTGCGGACTGGGTTAAGGCTGCTAGAGTACCCGGCTTCATCAGACGTTGGCTGTCTGAGCGTGTG
CACTACGTCGAGCGCCCCTTGGGAGGTTGGAGGCTAGCAGCTACTGATGCGCAGTGCCTCTCCAGTTCTA
CGGTATTTATTCCGCCAAGCCCGTGCTGTACTGAGCACCACGATTGTGCTGCTAACGCAGAGGTTTCCGA
TCTCACAGGGCCTGTGTTAGCACCGTGTGGGACGGGGCCGATCACGGAGATTCGCCGTCCTGGAATGGTG
GTTTCCCGTGGAACCATGCCTACTGTGGGGTCTCGACCAGCATTCCATTGGAGTGGTCAGGCGCCGACCA
TTGCTGAGAGCCGAAAGCTGGCTCTTTGCGAGGCCGTCGAGCGCGCATCCGCATGTGAGAATGAGGGAGC
AGGAGGCGTCGATACGCATATTCCCCACGTCCCTGCCACTGATTTTGGGGTGGACAACGAACGGTGGAAC
CGTTCTTACGATCATTGCCGCAATTGGACACGCGCTATTCGCCTGGGAGATGAAACCGCGTGGGCAGTCC
CCAGGGATATGGCGTTTTTCTGGTCTGACGCACAAGCTCGTTTTTGCTTCGATTCCTCCAGCGGCGCCGC
GGTGGGGCGCACATGGGAGGACGCGGTGATGTCTGGGTTAGCAGAGGTCATTGAACGTGACGCTGTCCTG
GCCGTATGGCATGGTTCCATGACCGTCCCAGAGATCAATGTTGACTCGATCAATGATCGCACTTACCAGG
CAATGCTGCGGCATCTTCGCAGGCAAGGGCTGGTTATCCGCGCGTTTTACTGCCCGCTGAGTGTAGGAGT
TCCTGCTGTTATTGCGGTATGCACGGATACTGAGCGCACTTTCCTCTGTGTTGGGGCAGCTGCCGCACCC
GATCCCTATGTCGCAGTACGCAAAGCTCTACGGGAGGTCATGGCGGATTATCCGCAGTCGCGTTTGCTTG
CTAGTACACGGTTGTCAGACGCTGCCGCAGTGCGTGCGGACGGTTCCGGGGCAGCTCATCGTCTCAGCGT
TGCTGCTTCCGAGCTTATCGACGCCGCCGCTTTCCTCCTCCTGCCCCGTAAAGAGCTGCTCCGTGTCTCC
GACATCCCGGGGTGCCCTCGCTTGTCTCTCGTTGAGCTAGTCGAGCGTCTCAAAGCACATGGCTTTTACG
GCTATGTTGTCGACTTCACCCATAGTTATCACCAAATGGTGGGGCTTTCAGCTGTCAAGGTTATTGTCCC
TGGTCTCTTGCCGCTGGAATATATCGGACAGCTGACTAGGGCATTGCATATGCCTAGGTTGAGGCAACAG
ATGACACGTTTTCGCGCTTTGGGCCTAGCCCCTCCCAGCTCACCTCCCCGTCTCAATCTTGTTCCGCACC
CGCTTCCCTAA
 Primer design

Protein Sequence:516 a.a.
>CD31A_1972|ThioFinder1505 Corynebacterium diphtheriae 31A
MTTRVAYLYCPARSFPAHALPPRHEQWIAVPSKVCRVCLNAWVDRTEEAADWVKAARVPGFIRRWLSERV
HYVERPLGGWRLAATDAQCLSSSTVFIPPSPCCTEHHDCAANAEVSDLTGPVLAPCGTGPITEIRRPGMV
VSRGTMPTVGSRPAFHWSGQAPTIAESRKLALCEAVERASACENEGAGGVDTHIPHVPATDFGVDNERWN
RSYDHCRNWTRAIRLGDETAWAVPRDMAFFWSDAQARFCFDSSSGAAVGRTWEDAVMSGLAEVIERDAVL
AVWHGSMTVPEINVDSINDRTYQAMLRHLRRQGLVIRAFYCPLSVGVPAVIAVCTDTERTFLCVGAAAAP
DPYVAVRKALREVMADYPQSRLLASTRLSDAAAVRADGSGAAHRLSVAASELIDAAAFLLLPRKELLRVS
DIPGCPRLSLVELVERLKAHGFYGYVVDFTHSYHQMVGLSAVKVIVPGLLPLEYIGQLTRALHMPRLRQQ
MTRFRALGLAPPSSPPRLNLVPHPLP