Home 

Gene Symbol:  
CDBH8_1950
Organism:  
Corynebacterium diphtheriae BH8
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2037369..2038382 [1], 1014 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_005161034.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1014 bp
>CDBH8_1950|ThioFinder1527 Corynebacterium diphtheriae BH8
ATGCGTACAACCGACCCCTGGCTCGCTTTTCATATTTTTTATGGAGAAGACCCTTCTCTCTTGCTCCGCG
ACTGCCTGCTGCCTTTTGCTCATACATGCGTTGCAGAAGGACTGGTAAAACGATTTTTCCATATGAATTA
CTGGTTGGAGGGTGCACACGTCCGCTTAAGGCTAGAGCTTTGCAATCCGGCAGATCGCGAGCGCGTCGTA
TGCGCAGCGCATCAGGCTATCCAACCGTGGATTGACTCCCATCCTTCCAGCGCGCCCCAGCTGTCCCTGC
GCAATCCCGAAGGTTATCGGCGCCTCTTTGAACACGAGTACCCCATGTCCAGGTTCTCCGACTATATCGA
TCAGGATGGTCTGCCCCGTCTACAACCAGATAACTGCATCCGAGAACGCTACTACGAGCGTGAATATGAC
CGCTACGGCGGACAGATAGGGATGTCGCTTAGCCAAGATGTTTTTCAAACCTCGACGTTGTTCGTCGAGA
AGCTTTTACACGCTGGCGTTTTAGAAGCACGTACCTCACGACTAGCCGCGGCTGCGCTAGGAATGATCTG
CACTGCGCATACAGTTTTGGCTTCCGACGCAGCCATAGGACGTTTTTGGGAAAGCTATCACGCAGGCTGG
ACCTCGTCTTTTTCTATGCCCACCAGCTACACCTCGCCCACGGCACAGCACAAAATTGCCACCGAGGCTC
AGGCGCTCTCACGCGCAGCCACGCCATTTCGTACGGCCTTGCGCCACGCCCCAGACGGTTCAAATCTTCC
CGAACCCTATGCCACTTTTACTCAACGCATGACCTCTCTCGTGGGCAAACTCCACGATGCATATGATTCC
CGAGAGCTTGATTTTGGTGATTCTGCGGCAGAGGCTGGCCACACGTGGAAAGAGAACTCCATTTTTCTTC
TGCGCTCCTATGTCCATATGACCAACAACAGAATGTCCGTCAATATCTCGGATGAGGCCTATTTAGCTTA
TTTACTGCACACGCTATATCGGGAGGCGCTATGA
 Primer design

Protein Sequence:337 a.a.
>CDBH8_1950|ThioFinder1527 Corynebacterium diphtheriae BH8
MRTTDPWLAFHIFYGEDPSLLLRDCLLPFAHTCVAEGLVKRFFHMNYWLEGAHVRLRLELCNPADRERVV
CAAHQAIQPWIDSHPSSAPQLSLRNPEGYRRLFEHEYPMSRFSDYIDQDGLPRLQPDNCIRERYYEREYD
RYGGQIGMSLSQDVFQTSTLFVEKLLHAGVLEARTSRLAAAALGMICTAHTVLASDAAIGRFWESYHAGW
TSSFSMPTSYTSPTAQHKIATEAQALSRAATPFRTALRHAPDGSNLPEPYATFTQRMTSLVGKLHDAYDS
RELDFGDSAAEAGHTWKENSIFLLRSYVHMTNNRMSVNISDEAYLAYLLHTLYREAL