Home 

Gene Symbol:  
CDC7B_1946
Organism:  
Corynebacterium diphtheriae C7
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2042908..2043921 [1], 1014 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_005163391.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1014 bp
>CDC7B_1946|ThioFinder1547 Corynebacterium diphtheriae C7
ATGCGTACAACCGACCCCTGGCTCGCTTTTCATATTTTTTATGGAGAAGACCCTTCTCTCTTGCTCCGCG
ACTGCCTGCTGCCTTTTGCTCATACATGCGTTGCAGAAGGACTGGTAAAACGATTTTTCCATATGAATTA
CTGGTTGGAGGGCGCACACGTCCGCTTAAGGCTAGAGCTTTGCAATCCGGCAGATCGCGAGCGCGTCGTA
TGCGCAGCGCATCAGGCTATCCAACCGTGGATTGACTCCCATCCTTCCAGCGCTCCCCAGCTGTCCCTGT
GCAATCCCGAAGGTTATCGGCGCCTCTTTGAACACGAGTACCCCATGTCCAGGTTCTCCGACTATATCGA
TCAGGATGGTCTGCCCCGTCTACAGCCAGATAACTGCATCCGAGAACGCTACTACGAGCGTGAATATGAC
CGCTACGGCGGACAGATAGGGATGTCGCTTAGCCAAGATGTTTTTCAAACCTCGACGTTGTTCGTCGAGA
AGCTTTTACACTCTGGCGTTTTAGAAGCACGTACCTCACGACTAGCCGCAGCTGCGCTAGGAATGATCTG
CACCGCGCATACAGTTTTGGATTCCGACGCAGCCATAGGACGCTTTTGGGAAAGCTATCACGCAGGTTGG
ACCTCGTCTTTTTCCATGCCCACCAGCTACACCTCGCCCACGGCACAGCACAAAATCGCCACCGAGGCTC
AGGCGCTCTCACGTGCAGCCACGCCATTTCGTGCGGCCTTGCGCCACGCCCCAGACGGTTCAAATCTTCC
CGAACCCTATGCCACTTTTACTCAACGCATGACCTCTCTCATGCGCAAACTCCACGATGCATATGATTCC
CGAGAGCTCGATTTTGGTGATTCTGCCGCAGAGGCCGGCCACACGTGGAAAGAAAATTCCATTTTTCTTC
TGCGCTCCTATGTCCATATGACCAACAACAGAATGTCCGTCAATATCTCGGATGAGGCCTATTTAGCTTA
TTTACTGCACGCGTTATATCAGGAGTCATTATGA
 Primer design

Protein Sequence:337 a.a.
>CDC7B_1946|ThioFinder1547 Corynebacterium diphtheriae C7
MRTTDPWLAFHIFYGEDPSLLLRDCLLPFAHTCVAEGLVKRFFHMNYWLEGAHVRLRLELCNPADRERVV
CAAHQAIQPWIDSHPSSAPQLSLCNPEGYRRLFEHEYPMSRFSDYIDQDGLPRLQPDNCIRERYYEREYD
RYGGQIGMSLSQDVFQTSTLFVEKLLHSGVLEARTSRLAAAALGMICTAHTVLDSDAAIGRFWESYHAGW
TSSFSMPTSYTSPTAQHKIATEAQALSRAATPFRAALRHAPDGSNLPEPYATFTQRMTSLMRKLHDAYDS
RELDFGDSAAEAGHTWKENSIFLLRSYVHMTNNRMSVNISDEAYLAYLLHALYQESL