Home 

Gene Symbol:  
CDC7B_1945
Organism:  
Corynebacterium diphtheriae C7
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2040308..2042908 [1], 2601 bp
Product Function:  
lantibiotic dehydratase domain-containing protein
Product Locus:  
 YP_005163390.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2601 bp
>CDC7B_1945|ThioFinder1546 Corynebacterium diphtheriae C7
ATGACAACTACTTCATGGAAACTTCTTAATGAAGCCCTGGTTCGCAGCTGCAGTGTGCCGTATGAGGCGT
TACGCCAGCTTTGCGACGCCCCCACCGACGCACTACTTACTGCCGATCTGGACCAGCGACTCCGCGTAAA
CGCGGCCCTTGATGCTCTTGATTCTGCGGCCCATCAGGACGTCGCGGGGTGCACAAACACAGTGTTGCGT
CGGGCTCTACTCGATCTCAAGCGAGCTGCACATCATCATGACGTGCGCAAAGTTCGTGCCCTGCTGGCTA
AAGCTACATCCGCTGGTGTGCGGTTGCCTGCTGGCGTAACGGCTGCCGCAGATACGGTGATCACTGCCGC
CGAAAACGTGCTGTCCTCAGAGCAGCTGCACAAGGTACTCATGAGTTCCAAGAAAAGAGAGCGCGAGTGC
CTCGGGAAGATCGCCCGTGACTGGGGAGTCGATTCAGCAGTGCTGGCTGCATCAGTCCCAGCGGCAATAG
CCATCCGGAAACTGAGCACAGATTGTGAGCTGTCTGCCAAGCAGCTAGCTCGTACCCACCGCACCGCGCT
GGGGTACGTGATCCGCAGCGCCACCCGGTCAGTACCGTTTTCCGCCCTGTGCGCAATCGCGCCGTCTCAG
TTGTCCCGCGCCAGCCTACACTCGGATGAGACTCTTGCCCCAACATCTGTGCACACTATTGCGCGTTGGA
ACGTCTACGCCATGGCTCAGATTTTCTCTGCTATGAAGAAGGACTTTGGTTTTATTGCCACACTTCCGGT
TCTGGTTAATCCTGACGCGTTATCAGAGCATGGTCACTGCGTACTGCCTCGGTGTTCTGTCGAATATCTA
GGGCACGTCGGCGACCGGGACTTGGCCGTTTACCGGGAGGAACGCCGAGTGGTGGATTCCAATGGACTAT
TTGGAAAGGTCATGGCCTTAGCCACAAGTGCTCCCCAAAACCACGAATACACGTGTGAGCAGCTGGCCGC
AGAGCTCTCGGCGCGTACAGGTTTAAGCAAGGCACAAACAAAGTGCATTGTTCTCGATGCCATCCGAATT
TCGGTCTTAGTTGTTCCCACTCTCGATTTATCCCCGTCCACAGCGGTATCTGAACAGCCGATAGTTACGC
ACTTGGCACGTGGGTCGGACAAGGCCGTATCTGCTGCGCGTCTCATTTCCCGCATCACGGAGGAATGCAA
CGCGGTGGCGTCGATAAGCGACTTTGACCGCAGGCACACTCAGATCCTAGATCTCGCGCACCACCTAGAT
AGCCTCTGGCGGCTCGTCGATCCCAGCATGCCGGCGTTCCATACCCATGTGTATGAGGATGGGGTCGGGA
AAGAATCGACGGTTCCCTCCTCCATCGTGGACTCGTGCACAGCCCTTGACTGGGAAGCTCTCGCAGACCT
AGTCGATCTGCTTGATGTGCGGCAGGCAGAACGCGCGTTGTTTGAGGAGTTTGTGTCCGCAAAATTCCCC
CGTGGGGAAATCTGCCACGATGTTCCGGCGGTGGTCAATAGTTTTGTCTCCGAGGTCCTCACGCCGCTGC
GGCAGGTTGATATTGAGGCAGTTGATGAAAATGACCTGAAGTCCACTGCATCGTTGCCACTGGGTAAGGC
ATGGGAATGGATTCGGGCGCGGCGCCGCTTCCTAGCACACGTAACCGAGTTAAGAAACAACGCCGCTGGT
CCCGTGGATATACGGAATCTCCTCACCAACTATCGTCCACTTGTGCAGTCTCGCAGGTATCCGCTTCGAT
CTTTAAACGCATACGTTCAGCAAGGCGACGAGGCCAAAGTCGTGATTAACCGGACGCTCGGCGGCCCAGG
CTTCCCGTGGTCTCGGTTCGCGCATGCGATGCCGGATTCCGCAGCACGCGCATGGTCCGAATTATCGGAT
TACGCGTCTGACGCTGGGGTGACGCTTGTCGAGTTGACAGCCGGAAAAGTGGTCTCCAACCTCAACGCAC
ATCCGGCCACCTACCCAACCACTCTCCTCATCCCAGGGCATCCTCGAGAAACCACACGGTCGTCTGATAT
TCGACTCGCAGACACGCAGTTGGCCTACTGCGCATCCAGCGGACGCTTGCAGCTTTTCGACGCCCACGGC
ACCGAGCTCCTCCCCGCATACATGGGATACATCACTGACCGGGGACTGCCATTATCTACGCAAGTCCTCA
TGCTCCTAGCGCCACCCATGCATTGTTCCTTGGACTTTTTCCCGCGCACGAGTTCAGAGATAGTGCATCA
GGCTCGTCTACTCCTAGGAGATGTTGTTCTTGCGCGAGAAAGCTGGATTTTTCCCACCTCAAGCACCTCT
ATGGATATTCCGTGTCTCCTAGAAGAGGCACTGGTGTGGTGGCGCAGCATTGCCCGACATCACGACCTAC
CCGAGTGCGGAGTTCTGCGAACATTCGATGCCCACGGCGTTGTGGGTAAAGGACAGTTTTATAACTCCCA
AATCATGGGAACGATCACCAACCTCATACGCGCATTGCGCAACGCTCACTACGGGTTTGTGATTGAGGAA
TTCTTTCCCCACGTCGGCGCGTCCGGTGTAGCACAGGAATACATAGTAACAGGAATGCGCTCTTTGAAGG
AGGGTATCTAA
 Primer design

Protein Sequence:866 a.a.
>CDC7B_1945|ThioFinder1546 Corynebacterium diphtheriae C7
MTTTSWKLLNEALVRSCSVPYEALRQLCDAPTDALLTADLDQRLRVNAALDALDSAAHQDVAGCTNTVLR
RALLDLKRAAHHHDVRKVRALLAKATSAGVRLPAGVTAAADTVITAAENVLSSEQLHKVLMSSKKREREC
LGKIARDWGVDSAVLAASVPAAIAIRKLSTDCELSAKQLARTHRTALGYVIRSATRSVPFSALCAIAPSQ
LSRASLHSDETLAPTSVHTIARWNVYAMAQIFSAMKKDFGFIATLPVLVNPDALSEHGHCVLPRCSVEYL
GHVGDRDLAVYREERRVVDSNGLFGKVMALATSAPQNHEYTCEQLAAELSARTGLSKAQTKCIVLDAIRI
SVLVVPTLDLSPSTAVSEQPIVTHLARGSDKAVSAARLISRITEECNAVASISDFDRRHTQILDLAHHLD
SLWRLVDPSMPAFHTHVYEDGVGKESTVPSSIVDSCTALDWEALADLVDLLDVRQAERALFEEFVSAKFP
RGEICHDVPAVVNSFVSEVLTPLRQVDIEAVDENDLKSTASLPLGKAWEWIRARRRFLAHVTELRNNAAG
PVDIRNLLTNYRPLVQSRRYPLRSLNAYVQQGDEAKVVINRTLGGPGFPWSRFAHAMPDSAARAWSELSD
YASDAGVTLVELTAGKVVSNLNAHPATYPTTLLIPGHPRETTRSSDIRLADTQLAYCASSGRLQLFDAHG
TELLPAYMGYITDRGLPLSTQVLMLLAPPMHCSLDFFPRTSSEIVHQARLLLGDVVLARESWIFPTSSTS
MDIPCLLEEALVWWRSIARHHDLPECGVLRTFDAHGVVGKGQFYNSQIMGTITNLIRALRNAHYGFVIEE
FFPHVGASGVAQEYIVTGMRSLKEGI